SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011230283.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230283.1.2219
Domain Number 1 Region: 29-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.3e-26
Family Extended AAA-ATPase domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011230283.1.2219
Sequence length 266
Comment MULTISPECIES: ATPase AAA [Geobacillus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MYKSFYSLSREPFAKETDPSEAYQGAPFQEALRALEYVKRTRGIGLLIGEPGAGKTFALR
ALKESLNPSLYHVVYFPLSTGGVMDFYRGLALGLGEEPKYRKVDLFRQIQQAIERLYHER
RITPVFILDEMHLAKDAFLQDIAILFNFEMDSTNPFVLILAGLPHLQGKLRLNQHHPLDQ
RIIMRYRMGPLEREEVAGYIEHRMKQAGAKHPIFTPSALEAIALQSRGWPRVINTLATTC
LLYGYQLKKDAIDEEVVRMAAEEMGY
Download sequence
Identical sequences A0A0K1K7C2 A0A2H5KG42 G5EAS3 L7ZX77 Q5L1W4
gi|448237948|ref|YP_007402006.1| WP_011230283.1.17728 WP_011230283.1.2219 235909.GK0781 235909.GK1917 gi|56419316|ref|YP_146634.1| gi|56420452|ref|YP_147770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]