SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011230448.1.8599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230448.1.8599
Domain Number 1 Region: 4-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-54
Family ABC transporter ATPase domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 274-491
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.49e-39
Family ABC transporter ATPase domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011230448.1.8599
Sequence length 516
Comment MULTISPECIES: sugar ABC transporter [Geobacillus]; AA=GCF_000236605.1; RF=na; TAX=1111068; STAX=33941; NAME=Geobacillus thermoleovorans CCB_US3_UF5; strain=CCB_US3_UF5; AL=Complete Genome; RT=Major
Sequence
MNGLSMRGMEKSFGAVRVLDGVDFDVRPGEVHALLGMNGAGKSTLMNILAGAIPPDAGTI
TIDGTIYTFSSPREAKQAGIGLVVQEVDTALFPGLPIYENVAADEFVHVKQRPIRSLRQE
KERAAALLRRVGLSLPPTKLVRDCSLHEKQLIVLAKVLSSNARYIILDEPTAALSEAETR
RLFAIIDELKQQGVGFIYISHKLKEVQEIADRLTILRDGRVVYHGGARSLPLEDIVLHMT
GTKRTAAAKQARTYRSDIAFAARGILIDKTGTTVDLYAHRGEIVGIAGLVGAGKTELAES
LIAHRNTSGEWEIDGRRYVFSSPYEAIDAGLCLIPEERRKQGLFLPESVKTNLTVRLLSR
LSRWQWISWAKEAAEADGLVRSLGVHPPSSTTVVRHLSGGNQQKVVIGKWLNTNARVFLF
DEPTKGIDVHAKQEVFSIIRSLADEGKTVLYFSSEFQELLDICDTIYVMVDGRLLARLPA
AELTYEQLVYYCSGGEIHEPASRFHNAVEKNGAVHS
Download sequence
Identical sequences A0A1C3D5R3 A0A1V9BTB8 Q5L1E8 T0Q5Q9 V6VB79
235909.GK0947 gi|56419482|ref|YP_146800.1| WP_011230448.1.100150 WP_011230448.1.2219 WP_011230448.1.22479 WP_011230448.1.25743 WP_011230448.1.45808 WP_011230448.1.70239 WP_011230448.1.78869 WP_011230448.1.8599 WP_011230448.1.90668 WP_011230448.1.91533 WP_011230448.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]