SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011230642.1.10946 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230642.1.10946
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-56
Family ABC transporter ATPase domain-like 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011230642.1.10946
Sequence length 288
Comment MULTISPECIES: ABC transporter ATP-binding protein [Geobacillus]; AA=GCF_001412125.1; RF=na; TAX=1699078; STAX=1699078; NAME=Geobacillus sp. PA-3; strain=PA-3; AL=Contig; RT=Major
Sequence
MAVVIEGLTKIVKKKPILSDVSLTLSGVYGLLGPNGAGKTTLMRIVAGLLEFNAGQVLLG
EERISTGTRVKRVNEIGYLPQEFMMYPELTMYEVLEHLAVLQGEHPAACRSKIEKVIEQV
NLSSHINKKMRELSGGMRRRVGIAMLLLREPSILLFDEPTAGLDIRERVRFRNLLKRLGH
DHTIVISSHLVEDIEFLCTKIGVLDRGTVLFEGSPDELKQKAAPYTYELEVPFAELDSIM
ATNEVVQMSEEPSHVVVRVLSEEPIGRRVAPRLMDGYLALLKEAEAHG
Download sequence
Identical sequences A0A063YUM0 A0A0Q0UK98 A0A1V9BXU9 A0A2H5KLE2 Q5L0V3
WP_011230642.1.10946 WP_011230642.1.19233 WP_011230642.1.2219 WP_011230642.1.38928 235909.GK1142 gi|56419677|ref|YP_146995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]