SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011230686.1.70239 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230686.1.70239
Domain Number 1 Region: 173-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.89e-63
Family Tandem AAA-ATPase domain 0.000000933
Further Details:      
 
Domain Number 2 Region: 436-638
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.42e-43
Family Tandem AAA-ATPase domain 0.00000394
Further Details:      
 
Domain Number 3 Region: 5-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-27
Family RecG "wedge" domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011230686.1.70239
Sequence length 682
Comment MULTISPECIES: DNA helicase RecG [Geobacillus thermoleovorans group]; AA=GCF_002077815.1; RF=na; TAX=33938; STAX=33938; NAME=Geobacillus thermocatenulatus; strain=SURF-48B; AL=Scaffold; RT=Major
Sequence
MNEAMQQPVTAVKGIGEETAAALADIGIATVGELLAYAPYRYDDYEQKDLAAVRHEEKVT
VEGKVYSAPLLTYYGKKKSRLSFRMLADRYLITVVCFNRPYLKEKIALNETVTVIGKWDR
HRQTINAYELRFGPAPETTGIEPVYSVRSPLTVKTMRRLMKAAFEQFGEHIPDPLPPALR
RAYRLVDKQEALRALHFPRTREELHQARRRLIYEEFLLYQLKMQALRRLMRDERRGVVHS
FSEERLSSFLSGLPFVLTNAQRRVIGEILADMRSPRQMNRLLQGDVGSGKTVVAAVALYA
AALSGFQGALMVPTEILAEQHARSLAELFADTDVTIALLTSSVKGKQRKAVLAELEEGTI
DIVVGTHALIQEGVQFRRLGLVITDEQHRFGVEQRRVLREKGHAPDVLMMTATPIPRTLA
ITAFGDMDVSVLDEMPAGRKKVETYWVKHHQFSRVLDFIEKELRRGHQAYVICPLIEESD
KLDVQNAIDVHSQLVHYYRGKYEIGLMHGRLSADEKERVMRAFSENRIHVLVSTTVVEVG
VNVPNATVMVIYDAERFGLAQLHQLRGRVGRGDAQSYCILIADPKSEVGKERMRIMTETA
DGFVLAEKDLELRGPGDFFGTKQSGLPEFRYGDPVHDYRILEVARRDAAKLVSSAAFWRD
EAYAGLRAELEASGILDGEKLD
Download sequence
Identical sequences A0A098L3Z1 A0A1D7NA21 A0A1V9C0U4 Q5L0Q9
235909.GK1186 gi|56419721|ref|YP_147039.1| WP_011230686.1.2219 WP_011230686.1.6497 WP_011230686.1.70239 WP_011230686.1.78869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]