SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011230694.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230694.1.2219
Domain Number 1 Region: 123-321
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-52
Family Nitrogenase iron protein-like 0.000000652
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 1.2e-21
Family Domain of the SRP/SRP receptor G-proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011230694.1.2219
Sequence length 328
Comment signal recognition particle-docking protein FtsY [Geobacillus kaustophilus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MGFFQKWKEKWTKQADAVTEKFKEGLSKTRNSLAGKVNDLIARYRKVDEEFFEELEEILI
AADVGVTTVMELVDELKMEVKRRNIQDPAQMRDVIAEKLVDIYRAGADGKELSALNIQEG
GLTVILFVGVNGVGKTTTIGKLAHKLKSEGKSVLLAAGDTFRAGAIEQLEAWGERVGVDV
IKQAAGSDPAAVMYDAIQAAKARGVDVLLCDTAGRLQNKVNLMKELEKVKRVISREIPGA
PHEVLLVLDATTGQNAMSQAKLFKEATDVTGIVLTKLDGTAKGGIVLAIRNEMAIPVKLV
GLGEKMDDLQVFDPEQYVYGLFADLLES
Download sequence
Identical sequences Q5L0Q1
gi|56419729|ref|YP_147047.1| WP_011230694.1.2219 235909.GK1194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]