SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011231033.1.91533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011231033.1.91533
Domain Number 1 Region: 16-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-44
Family Tandem AAA-ATPase domain 0.0027
Further Details:      
 
Domain Number 2 Region: 69-124,305-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.8e-34
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011231033.1.91533
Sequence length 758
Comment MULTISPECIES: ATP-dependent helicase [Geobacillus]; AA=GCF_000617945.1; RF=na; TAX=1048208; STAX=1048208; NAME=Geobacillus sp. FW23; strain=FW23; AL=Contig; RT=Major
Sequence
MKKQTLSEWIEQLRQDPNVVHWHEIEPKEANFVPFPDELDPRLGAALKARGIASLYTHQA
AAYDAVQSGRNIVAVTPTASGKTLCYNLPVLDAIAKEPSSRALYIFPTKALAQDQKNELN
EIIAEMGVSIYSHTYDGDTAPALRQKIRQAGHIVITNPDMLHTAILPHHTKWISLFEQLR
YVVIDELHTYRGVFGSHVANVIRRLKRICAFYGSRPTFICTSATIANPKELAERLIGEPV
ALIDNNGAPRGRKYFVFYNPPVVERTMNIRQSATKTAVELARQLLVNRIPTIVFARSRVR
VELILSHLQAVVNERIGDTTIRGYRGGYLPNERRAIEKGLRSGEIIGVVSTNALELGVDI
GQLQACILTGYPGTIASTWQQAGRAGRRQGDSLVVMIASASPLDQYIISHPEYFFARSPE
AARINPDNLLILVDHIKCAAYELPFRRGETFGGVEVEEVLDFLAEQGVLNERAGRWHWMS
DAFPAHDISLRSAAQENVVIIDISDTAHHRVIGEMDRFSAMTLLHDEAIYLHEGAQYQVE
KLDWEEKKAYVRQVDVEYFTDANLAVRLDVLSEDRSETRGQMAVRYGDVSVRAMATIFKK
LKLSTFENIGSGPIRLPEETLHTSAAWIEWEAVPSRFSPALFEQLLVGIANVLGHLVPVF
VMCDRSDLHVVPQLKAPHSGRPTIFLYDRYPGGVGLSEAVFERYEEIMKHVKEWVERCPC
ADGCPSCIGISSADGPSLKRELVQFLDEQLAVWAGPSV
Download sequence
Identical sequences A0A098L493 A0A1C3D1K2 Q5KZR4
gi|56420072|ref|YP_147390.1| 235909.GK1537 WP_011231033.1.2219 WP_011231033.1.22479 WP_011231033.1.60903 WP_011231033.1.6497 WP_011231033.1.78869 WP_011231033.1.91533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]