SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011231040.1.78869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011231040.1.78869
Domain Number 1 Region: 52-107,203-281,422-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.75e-21
Family Tandem AAA-ATPase domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011231040.1.78869
Sequence length 645
Comment MULTISPECIES: ATP-dependent helicase [Geobacillus]; AA=GCF_000474195.1; RF=na; TAX=1406857; STAX=33941; NAME=Geobacillus thermoleovorans B23; strain=B23; AL=Contig; RT=Major
Sequence
MGHERYPFVVEKNENFFDKLSQWIGDVFYDILPEAGFELRDEQIYMAFQLERAFREKKVI
FAEAGVGTGKTIVYLLYAVCYARYTGKPAIIACADETLIEQLVKKEGDIAKLSNVLGLEI
DVRLAKSPDQYLCLNKLEEVTTYDDDDIELYEQIYDELPAFVHDNKPLQSFYRYGDRKEY
AHLTDEQWKKIAWDPFQDCFTCEKRHRCGQTLWRDYYRKAADLIVCSHDFYMEHVWTYEA
RKREGQLPLLPEASCVVFDEGHLLEFAAQKALTYRMKETTLETLLTRLLENDIREELAYL
IEETLETSTRFFDELKACAKDVPGSNRKEILPSPRLEQWAKRLRGQMVEIGNELVFESET
YTIDHYQLNIVDEYLDQIQYSLDLFLKNADAITWLESSRQEATFVVMPRTVQEVLREKVF
SKRMPFIFSSATLSSGKSFAYIAQSLGIDDYLSFSVPSPFDYDEQMTIFMPTFRADETLF
AKKYAYALEKLRETGGRALILFPTREELLQFKEAAAGEPFSFLFEGDREISDLVAEFQRN
EETVLCSEHLWEGLDIPGPSLSNVIIWSLPYPPNDPVFQAKRKAYSNPFWDVDVPYMLLR
LRQGVGRLIRTRDDRGIVSIFVTDREDERVIAAIKDVLPTAVREE
Download sequence
Identical sequences A0A1C3D282 A0A1V9BUW0 A0A2H5KEG0 Q5KZQ7
WP_011231040.1.2219 WP_011231040.1.22479 WP_011231040.1.60903 WP_011231040.1.70239 WP_011231040.1.78869 WP_011231040.1.8599 WP_011231040.1.90668 WP_011231040.1.91533 WP_011231040.1.93593 gi|56420079|ref|YP_147397.1| 235909.GK1544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]