SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011232044.1.91533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011232044.1.91533
Domain Number 1 Region: 241-424
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 4.93e-70
Family MgsA/YrvN C-terminal domain-like 0.000000319
Further Details:      
 
Domain Number 2 Region: 3-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-47
Family Extended AAA-ATPase domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011232044.1.91533
Sequence length 431
Comment MULTISPECIES: recombinase RarA [Geobacillus]; AA=GCF_000617945.1; RF=na; TAX=1048208; STAX=1048208; NAME=Geobacillus sp. FW23; strain=FW23; AL=Contig; RT=Major
Sequence
MPKTTEPLAWRMRPRTIDEIVGQQHIIGPSTPLYKMVKKGHVPSLLLYGEPGTGKTSLAY
AIARTAGREWVAINATAAGKKEIEEAVEAARWSGNVVLFIDEIHRLNKAQQDVLLPHLES
GLVTLIGATTENPFHEVNPAIRSRCGQIQQLKPLKPDDLMIILKRALADPERGVGEPPVV
IDESLLWRIAEAAGGDARVALSLLEAAVAAADERHGRLYIDEDIVASCTANRGFTHDKYG
DHYYSLLSAFQKSVRGSDADAALHYLARLLEGGDLASVCRRLLVMAYEDIGLANPMMGVK
VQAAVEAAERLGLPEARIPLAVVTIELCLSPKSNSAYKALDAAIADVRSGKLGDIPDHLK
DAHYKGAAALGRGQGYLYPHDYPNGWVAQAYLPSALEGVRYYEPKEHGEEKHYAKVYRRL
EQLKQEVKVQP
Download sequence
Identical sequences A0A098L194 A0A1C3D6N8 A0A1V9BUE6 A0A2H5KKR8 G8N3G0 Q5KWT4 T0Q8A4 U2Y0W7 V6V9U2
gi|375009661|ref|YP_004983294.1| WP_011232044.1.100150 WP_011232044.1.2219 WP_011232044.1.22479 WP_011232044.1.25743 WP_011232044.1.45808 WP_011232044.1.60903 WP_011232044.1.6497 WP_011232044.1.70239 WP_011232044.1.78869 WP_011232044.1.8599 WP_011232044.1.90668 WP_011232044.1.91533 WP_011232044.1.93593 235909.GK2567 gi|56421102|ref|YP_148420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]