SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011232104.1.70239 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011232104.1.70239
Domain Number 1 Region: 4-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-70
Family RecA protein-like (ATPase-domain) 0.0000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011232104.1.70239
Sequence length 351
Comment MULTISPECIES: twitching motility protein PilT [Geobacillus]; AA=GCF_002077815.1; RF=na; TAX=33938; STAX=33938; NAME=Geobacillus thermocatenulatus; strain=SURF-48B; AL=Scaffold; RT=Major
Sequence
MKEKLEALLRAAFEYRASDVHLTVGAPPIFRVNGELKAYGQERLNPEDTEQMAKAIIPPP
LWQQFQETGELDFSYGIAGVSRFRINVFKQRSCVSLAVRLIPPRIPTLEELGLPSVLKRI
AEKPHGLVLVTGPTGSGKSTTLAAMIDYMNKTMSRHIITLEDPIEYLHQHGKSIIDQREV
GFDTNSFAAGLRAALRQDPDVILVGEMRDLETIQTAITAAETGHLVLGTLHTASAPAAIE
RMIDVFPSAQQAQIRLQLASVLVAVMAQRLFPDGRKRGRTAAMEILINNAAVANLIRNEK
EHQIINIMQTGRSVGMQTMEMSVRELVAAGRIDPLAAEAYLTRERGADGAI
Download sequence
Identical sequences A0A063YQM3 A0A087LD57 A0A0K1K981 A0A1V9BVL6 A0A2H5KKL8 Q5KWM3 T0NW42
gi|56421163|ref|YP_148481.1| WP_011232104.1.100150 WP_011232104.1.19233 WP_011232104.1.2219 WP_011232104.1.38513 WP_011232104.1.43576 WP_011232104.1.45808 WP_011232104.1.59290 WP_011232104.1.70239 235909.GK2628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]