SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011232328.1.8599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011232328.1.8599
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-62
Family ABC transporter ATPase domain-like 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011232328.1.8599
Sequence length 263
Comment MULTISPECIES: spermidine/putrescine ABC transporter ATP-binding protein [Geobacillus]; AA=GCF_000236605.1; RF=na; TAX=1111068; STAX=33941; NAME=Geobacillus thermoleovorans CCB_US3_UF5; strain=CCB_US3_UF5; AL=Complete Genome; RT=Major
Sequence
MFLSIDRLSHTYLTKTTAVTALDDVSLSVEKGEFVSFLGPSGCGKTTLLSIIAGLIEPTE
GAVHIEGQPIWPSGTAAPAARRAVGYMLQQDYLFPWKTIEENILLGLKITDTLTADTKER
ALALLSEIGLAGVELYYPSQLSGGMRQRAALVRTLATDPKLLLLDEPFSALDQQTKLKLE
ELVWKTLKQYEKTAVLVTHDIEEAIAMSDRIFLFSPRPGRLVRTFVIPDELRCRPPLAAR
QQPSFPALFQSIWKEMEALESAQ
Download sequence
Identical sequences A0A1V9BVI2 G8N652 Q5KVZ5
235909.GK2856 WP_011232328.1.2219 WP_011232328.1.45808 WP_011232328.1.60903 WP_011232328.1.70239 WP_011232328.1.8599 WP_011232328.1.91533 WP_011232328.1.93593 gi|56421391|ref|YP_148709.1| gi|375009982|ref|YP_004983615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]