SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011232827.1.80994 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011232827.1.80994
Domain Number 1 Region: 95-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.86e-99
Family RecA protein-like (ATPase-domain) 0.0000000003
Further Details:      
 
Domain Number 2 Region: 372-500
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 1.31e-48
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.000000254
Further Details:      
 
Domain Number 3 Region: 10-94
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.73e-31
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011232827.1.80994
Sequence length 502
Comment MULTISPECIES: ATP synthase subunit alpha [Geobacillus]; AA=GCF_000024705.1; RF=na; TAX=544556; STAX=544556; NAME=Geobacillus sp. Y412MC61; strain=Y412MC61; AL=Complete Genome; RT=Major
Sequence
MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVM
GMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGP
VETTETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAI
DTIINQKDQNMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPY
AGVAMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLER
AAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAG
LSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVL
KQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLWLDQNGQHLLEHIRTTKD
LPNEDDLNKAIEAFKKTFVVSQ
Download sequence
Identical sequences A0A063YVS8 A0A0E0TGE9 A0A1D7NFK3 A0A1V4PCD7 A0A1V9BY73 A0A2H5KIQ7 G8MZV6 Q5KUJ1 T0QD23 V6VI17
gi|319768435|ref|YP_004133936.1| gi|56421895|ref|YP_149213.1| WP_011232827.1.100150 WP_011232827.1.19233 WP_011232827.1.2219 WP_011232827.1.25743 WP_011232827.1.3446 WP_011232827.1.45808 WP_011232827.1.46340 WP_011232827.1.50933 WP_011232827.1.60903 WP_011232827.1.6497 WP_011232827.1.70239 WP_011232827.1.78869 WP_011232827.1.80994 WP_011232827.1.8599 WP_011232827.1.90668 WP_011232827.1.93593 gi|297531560|ref|YP_003672835.1| gi|261420765|ref|YP_003254447.1| 235909.GK3360 544556.GYMC61_3417 gi|375010540|ref|YP_004984173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]