SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011232953.1.92435 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011232953.1.92435
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.96e-74
Family Nitrogenase iron protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011232953.1.92435
Sequence length 253
Comment MULTISPECIES: sporulation initiation inhibitor Soj [Geobacillus]; AA=GCF_002077835.1; RF=na; TAX=33938; STAX=33938; NAME=Geobacillus thermocatenulatus; strain=SURF-189; AL=Scaffold; RT=Major
Sequence
MGKVIAIANQKGGVGKTTTAVNLSACLAHLGKKVLLVDADPQGNATSGIGIERGDVDECI
YNVIIGDMKAKDVIRPTDIENLYVIPATIQLAGAEIELVSVISREIRLRNAIEPLKDKYD
FIIIDCPPSLGLLTLNALTAANSVLIPVQCEYYALEGLSQLLNTIRLVQRHLNYDLRLEG
VLLTMLDARTNLGLQVIQEVKKYFREKVYQTIIPRNVRLSEAPSHGKPIILYDVKSRGAE
VYLELAKEVLERG
Download sequence
Identical sequences A0A0D8BV72 A0A0E0THR8 A0A0K2H8L4 A0A142D4N3 A0A1Q5T9A0 A0A1V4PAP5 A0A1V9C2J5 L8A3K5 Q5KU61 S7U3J3
gi|261420898|ref|YP_003254580.1| gi|297531683|ref|YP_003672958.1| WP_011232953.1.13089 WP_011232953.1.17728 WP_011232953.1.20723 WP_011232953.1.2219 WP_011232953.1.3446 WP_011232953.1.38260 WP_011232953.1.38928 WP_011232953.1.46340 WP_011232953.1.50933 WP_011232953.1.59104 WP_011232953.1.65208 WP_011232953.1.72400 WP_011232953.1.77642 WP_011232953.1.80994 WP_011232953.1.86012 WP_011232953.1.9165 WP_011232953.1.92435 235909.GK3490 544556.GYMC61_3553 gi|448239762|ref|YP_007403820.1| gi|319768569|ref|YP_004134070.1| gi|56422025|ref|YP_149343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]