SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011243632.1.45845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243632.1.45845
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.17e-104
Family Cystathionine synthase-like 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011243632.1.45845
Sequence length 382
Comment MULTISPECIES: class V aminotransferase [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence
MEDKLMLMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTTGNVLVLC
SSGTGAMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAI
RAKLEADTDKQIKAVILTHSETSTGVINDLETISGYIRAHGALSIVDAVTSLGAANVPID
AWGLDVVASGSQKGYMIPPGLGFVAVSDRAWKAYETATLPKFYLDLGKYRKAAQKDSNPF
TPPVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLPLYAADEVGSPAITA
VAPVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAALT
GLGYSNFTSGAGVAAAAAELAK
Download sequence
Identical sequences A0A0H3K2P4 Q31RU6
WP_011243632.1.45845 WP_011243632.1.5740 WP_011243632.1.95485 gi|56751329|ref|YP_172030.1| gi|81299002|ref|YP_399210.1| 1140.Synpcc7942_0191 269084.syc1320_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]