SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011243862.1.45845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243862.1.45845
Domain Number 1 Region: 3-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5e-102
Family Cystathionine synthase-like 0.0000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011243862.1.45845
Sequence length 388
Comment MULTISPECIES: IscS subfamily cysteine desulfurase [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence
MSKDPIYLDYHATTPVDSRVVTAMQPFWGEQFGNPASRSHRYGLEAAAAVQVARETLATA
IAAQPEELIFCSGATEANNLAIKGVAETQHRKGQHLITVATEHQAVLSPCRYLESLGFQL
TVLPVNSQGLISVEQVAAALRPDTILVSVMAANNEIGVLQPIAAIGALCRDRGVVFHCDA
AQALGRIPFNVSDLNVDLLSLSGHKVYGPKGIGLLYRRSGVAIAPQLHGGSQEQGLRAGT
LAPALIVGFAQATELAIAEQPTETLRLQTLRDRLWQGLQAIGGLHLNGDPQQRLPSNLNF
SIEGIDPSRLIQRIRGAIAVSSGSACSSGNAEPSHVLTAIGRSPDLAHASLRIGLGRFTI
AEEIDRTLEILIAAIQAERSRLTRHKKG
Download sequence
Identical sequences A0A0H3K6I1 Q31K31
WP_011243862.1.45845 WP_011243862.1.5740 WP_011243862.1.95485 gi|56751561|ref|YP_172262.1| gi|81301367|ref|YP_401575.1| 1140.Synpcc7942_2558 269084.syc1552_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]