SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011253063.1.61435 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011253063.1.61435
Domain Number 1 Region: 126-274
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.57e-44
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00014
Further Details:      
 
Domain Number 2 Region: 8-122
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 6.12e-31
Family DHN aldolase/epimerase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011253063.1.61435
Sequence length 299
Comment folate biosynthesis protein [Gluconobacter oxydans]; AA=GCF_000507285.1; RF=na; TAX=1435296; STAX=442; NAME=Gluconobacter oxydans DSM 2003; strain=DSM 2003; AL=Contig; RT=Major
Sequence
MITPALTSVFVRDLCLFGYHGVLPEETRIGQRFVVDIEIRADLSGAIAGDDYEQAVCYGT
LCDIASAIVTGPPLQLIETVAGRIAEAVLAKLERVEWVRVEVRKPSAPVPYAVSGTAVSV
EQVRVHEVAFSLGSNLGEREAVLAAAVDRLSLVDGLEIGKVSSLYDSAPWGGVEQPTFVN
ICATGRTTLEPHALLRVCKAIEADLGRVPGVRWGARAVDIDILYYGEREIRDRVLTLPHA
CLFERAFVLEPLAEIDPDHVIGGRRVRDALAVLPRSPGDVTRRAPDGTGRWGIKEPEPA
Download sequence
Identical sequences Q5FQR8
290633.GOX1536 gi|58039970|ref|YP_191934.1| WP_011253063.1.61435 WP_011253063.1.92951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]