SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011253063.1.92951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011253063.1.92951
Domain Number 1 Region: 126-274
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.57e-44
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00014
Further Details:      
 
Domain Number 2 Region: 8-122
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 6.12e-31
Family DHN aldolase/epimerase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011253063.1.92951
Sequence length 299
Comment folate biosynthesis protein [Gluconobacter oxydans]; AA=GCF_000011685.1; RF=representative genome; TAX=290633; STAX=442; NAME=Gluconobacter oxydans 621H; strain=621H; AL=Complete Genome; RT=Major
Sequence
MITPALTSVFVRDLCLFGYHGVLPEETRIGQRFVVDIEIRADLSGAIAGDDYEQAVCYGT
LCDIASAIVTGPPLQLIETVAGRIAEAVLAKLERVEWVRVEVRKPSAPVPYAVSGTAVSV
EQVRVHEVAFSLGSNLGEREAVLAAAVDRLSLVDGLEIGKVSSLYDSAPWGGVEQPTFVN
ICATGRTTLEPHALLRVCKAIEADLGRVPGVRWGARAVDIDILYYGEREIRDRVLTLPHA
CLFERAFVLEPLAEIDPDHVIGGRRVRDALAVLPRSPGDVTRRAPDGTGRWGIKEPEPA
Download sequence
Identical sequences Q5FQR8
290633.GOX1536 WP_011253063.1.61435 WP_011253063.1.92951 gi|58039970|ref|YP_191934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]