SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011258973.1.2575 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011258973.1.2575
Domain Number 1 Region: 53-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000254
Family RecA protein-like (ATPase-domain) 0.087
Further Details:      
 
Weak hits

Sequence:  WP_011258973.1.2575
Domain Number - Region: 253-317
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0177
Family D-glucarate dehydratase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011258973.1.2575
Sequence length 346
Comment tetraacyldisaccharide 4'-kinase [Xanthomonas oryzae]; AA=GCF_001746715.1; RF=na; TAX=64187; STAX=347; NAME=Xanthomonas oryzae pv. oryzae; strain=PXO563; AL=Complete Genome; RT=Major
Sequence
MSKRGARTPGFWYDNNTPIPLPARILVPVYGAAIALRRALYRRGWRKRHGVPVPVIVVGN
VTAGGTGKTPLTIALVAKLQEAGWTPGVASRGYGRDEAGKARWVEADTPVALGGDEPVLI
AWKTGARVRVDSDRLAAARALVEAGCDIVICDDGLQHYRLARDVEIEVVDGQRRYGNGRL
LPAGPLREPVARARDCDFRVVNLGQASTTAAPQAPDDAGFGEWQMRLSIDSVQPMDGKRA
QPLSMLAGQRVHAVAGIAYPERFFAMLRARGIGVVPHAFPDHHVYRAADFSFGSRLPVLM
TEKDAVKCRPFADEWLYSVPLKAELPAAFWVSLLDRLNKLASRQGV
Download sequence
Identical sequences A0A0U4MYJ8 B2SKI3 Q2P3E8 Q5H0H1
291331.XOO2296 342109.XOO_2174 360094.PXO_00587 gi|84623831|ref|YP_451203.1| XoR40 WP_011258973.1.100287 WP_011258973.1.101918 WP_011258973.1.10801 WP_011258973.1.11746 WP_011258973.1.11992 WP_011258973.1.12016 WP_011258973.1.12038 WP_011258973.1.12284 WP_011258973.1.12532 WP_011258973.1.13943 WP_011258973.1.15664 WP_011258973.1.16001 WP_011258973.1.19029 WP_011258973.1.19407 WP_011258973.1.19779 WP_011258973.1.20356 WP_011258973.1.21407 WP_011258973.1.22155 WP_011258973.1.22948 WP_011258973.1.2575 WP_011258973.1.27990 WP_011258973.1.28412 WP_011258973.1.29999 WP_011258973.1.30088 WP_011258973.1.3010 WP_011258973.1.32656 WP_011258973.1.34187 WP_011258973.1.34656 WP_011258973.1.34831 WP_011258973.1.353 WP_011258973.1.35359 WP_011258973.1.38499 WP_011258973.1.39578 WP_011258973.1.40044 WP_011258973.1.40785 WP_011258973.1.41276 WP_011258973.1.42687 WP_011258973.1.42954 WP_011258973.1.43671 WP_011258973.1.44430 WP_011258973.1.45003 WP_011258973.1.4539 WP_011258973.1.46170 WP_011258973.1.47084 WP_011258973.1.47137 WP_011258973.1.48014 WP_011258973.1.48578 WP_011258973.1.49044 WP_011258973.1.49225 WP_011258973.1.49377 WP_011258973.1.50457 WP_011258973.1.50569 WP_011258973.1.51059 WP_011258973.1.52109 WP_011258973.1.53330 WP_011258973.1.537 WP_011258973.1.55471 WP_011258973.1.56638 WP_011258973.1.56661 WP_011258973.1.57225 WP_011258973.1.57350 WP_011258973.1.57652 WP_011258973.1.57864 WP_011258973.1.57935 WP_011258973.1.58736 WP_011258973.1.60363 WP_011258973.1.60953 WP_011258973.1.61025 WP_011258973.1.61774 WP_011258973.1.61876 WP_011258973.1.63306 WP_011258973.1.65775 WP_011258973.1.67359 WP_011258973.1.67821 WP_011258973.1.68588 WP_011258973.1.68727 WP_011258973.1.68760 WP_011258973.1.69729 WP_011258973.1.71791 WP_011258973.1.73657 WP_011258973.1.74787 WP_011258973.1.75518 WP_011258973.1.76491 WP_011258973.1.76573 WP_011258973.1.76801 WP_011258973.1.8070 WP_011258973.1.81518 WP_011258973.1.8269 WP_011258973.1.82912 WP_011258973.1.83077 WP_011258973.1.8313 WP_011258973.1.83277 WP_011258973.1.85262 WP_011258973.1.85266 WP_011258973.1.86486 WP_011258973.1.87020 WP_011258973.1.87238 WP_011258973.1.88561 WP_011258973.1.89095 WP_011258973.1.90241 WP_011258973.1.91866 WP_011258973.1.91997 WP_011258973.1.93038 WP_011258973.1.94099 WP_011258973.1.94601 WP_011258973.1.95101 WP_011258973.1.95975 WP_011258973.1.96729 WP_011258973.1.97155 WP_011258973.1.97395 WP_011258973.1.99258 gi|188576508|ref|YP_001913437.1| gi|58581919|ref|YP_200935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]