SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011261256.1.21775 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011261256.1.21775
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 3.27e-25
Family YhbC-like, N-terminal domain 0.00084
Further Details:      
 
Domain Number 2 Region: 84-151
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 5.1e-17
Family YhbC-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011261256.1.21775
Sequence length 151
Comment ribosome maturation factor [Aliivibrio fischeri]; AA=GCF_001640415.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=MB13B1; AL=Contig; RT=Major
Sequence
MTGLERQLTEMLEAPVGALGYELVGLEFVRAGEHSTLRVFIDHENGIFVEDCAEASRQIS
AVMDVEDPITVAYNLEVSSPGLERPLFKAAHYQQFVGHEVSLVLKMPMNNRRKWKGDILE
INGEIVTVTVDGNNEEFALSNISKANLVPKF
Download sequence
Identical sequences Q5E7L7
WP_011261256.1.100783 WP_011261256.1.102040 WP_011261256.1.11820 WP_011261256.1.21775 WP_011261256.1.21836 WP_011261256.1.23113 WP_011261256.1.34959 WP_011261256.1.66091 WP_011261256.1.76652 WP_011261256.1.77059 WP_011261256.1.80135 WP_011261256.1.82276 WP_011261256.1.94618 YP_203867.1.56684 gi|59711091|ref|YP_203867.1| 312309.VF_0484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]