SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011261425.1.76652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011261425.1.76652
Domain Number 1 Region: 148-367
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 7.16e-53
Family RibD C-terminal domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 7-148
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 6.36e-46
Family Deoxycytidylate deaminase-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011261425.1.76652
Sequence length 372
Comment riboflavin biosynthesis protein RibD [Aliivibrio fischeri]; AA=GCF_001029395.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=VCW2E2; AL=Scaffold; RT=Major
Sequence
MTFTTQDHLMMQKAILLAKQGIYTTAPNPNVGCVLVKNGKIIGEGAHLKAGEPHAEVHAL
RQAGKEAQGATAYVTLEPCSHYGRTPPCAEGLIKAGVKKVICAMVDPNPQVAGRGLAMLD
EAGIETASGLLEADARALNPHFLTRMETGKPFVQLKMAASLDGKTALKNGVSQWITSKEA
RQDVQRYRAQSGAILSTAKTVIDDDASLNVRWSDLPPSIQESYQQASIRQPMRFILDRQH
SLTSDLKLFQASDEVVTISSQNTHPIGTSENHMQCRVDDGQLDLKEVVNKISRDFNVNHI
WVEAGATLAASMINDNLVDELIIYLAPKLMGADGRSIINLIGLETMSEAIDLDIKDIRMV
GKDIRITATIAR
Download sequence
Identical sequences Q5E701
gi|59711307|ref|YP_204083.1| WP_011261425.1.76652 YP_204083.1.56684 312309.VF_0700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]