SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011261960.1.76652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011261960.1.76652
Domain Number 1 Region: 15-267
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.02e-70
Family FdhD/NarQ 0.0000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011261960.1.76652
Sequence length 273
Comment sulfurtransferase FdhD [Aliivibrio fischeri]; AA=GCF_001029395.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=VCW2E2; AL=Scaffold; RT=Major
Sequence
MSQSPKIITTGTVPKQTISVDVYDEYGEKLTKEIACEQPLTVMLNWQEVVTLMTLGARPA
ELVLGYLKNQHFVTDASLLESVIIDWETKTAAVNTKETTEHVKENLKKKTVTSGCGQGTM
YGNVMKQLENYQVPQVTINQSDLYESLEALTYHNDTYKAAGAVHGCAVCKDNKVLSFVED
VGRHNAVDTLAGELWLKQEAGDDKLFYTTGRLTSEMVIKVAQMGIPVLLSRSGVTQMGLD
LAKKFGITIIARAKGKRFQVFAGHEKINFDVKG
Download sequence
Identical sequences Q5E535
gi|59711973|ref|YP_204749.1| WP_011261960.1.76652 WP_011261960.1.80135 YP_204749.1.56684 312309.VF_1366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]