SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011262070.1.76652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011262070.1.76652
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.01e-36
Family Cytidine deaminase 0.0000233
Further Details:      
 
Domain Number 2 Region: 155-286
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 6.36e-36
Family Cytidine deaminase 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011262070.1.76652
Sequence length 297
Comment cytidine deaminase [Aliivibrio fischeri]; AA=GCF_001029395.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=VCW2E2; AL=Scaffold; RT=Major
Sequence
MTRLQQRLEEALANLPDALRTSLTPIINTEFKGVISKEQFQSLQADSQLSDKELRLALLP
LAAAFSVAPISNFYVGAIARGLTGNLYFGANMEYNDVQLGQTIHAEQSAISHAWIQGETG
ISNITINFSPCGHCRQFMNELTTADSLMVQLPERNEKSLQEYLPESFGPKDLGIEGGLLA
PLSHNLALETESPLLRKALEAANRSHAPYSHNLSGIALEMESGEVYYGMYAENAAFNPSL
PPLQVALVHANMSREDILTVKSAALVEDHKGAISHLAITQSTLEALNPDVTLEYASL
Download sequence
Identical sequences Q5E4R6
gi|59712092|ref|YP_204868.1| WP_011262070.1.76652 YP_204868.1.56684 312309.VF_1485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]