SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011263640.1.76652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011263640.1.76652
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.44e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 82-195
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.9e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011263640.1.76652
Sequence length 236
Comment glutathione S-transferase [Aliivibrio fischeri]; AA=GCF_001029395.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=VCW2E2; AL=Scaffold; RT=Major
Sequence
MIKLISFNNCPFVQRVMGALVTKNVAFEIEYIELNNKPQWFLDIAPNGQVPVLITEDKTV
LFESDAIVEYLDDKYAPIEDLTPEQRAIDRAWSYQASKHYMPQCGTMGSKDKETFETRLA
NLSKAFAKAEGKLSDSLFFKGDYISNVDIAWLPLLHRAAVIKDQSGFDMLDGFPKVQKWQ
ASLIESGLAEKTVPQDFVATFSGFYLKNTYLAHVMNGTEAECAEGRCSTDSSSCCN
Download sequence
Identical sequences Q5DZA5
gi|59714004|ref|YP_206779.1| 312309.VF_A0821 WP_011263640.1.76652 YP_206779.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]