SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011264603.1.31918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011264603.1.31918
Domain Number 1 Region: 20-170
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-32
Family Prokaryotic PEBP-like proteins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011264603.1.31918
Sequence length 172
Comment putative phospholipid binding protein [Mycoplasma mobile]; AA=GCF_000008365.1; RF=representative genome; TAX=267748; STAX=2118; NAME=Mycoplasma mobile 163K; strain=163K; AL=Complete Genome; RT=Major
Sequence
MKIKSNNVKNSILHPDFGGYGNKMDKNQAPSHSLHLEWEEVSGAKSYALEMIDYEASGVV
GFPFIHWVVANIKTNSLEEGASLKNQSILQGVNSRTPKGIVPEAFRAPTIELASQYFGPY
PPDQSHDYVIRIYALNVEKLNLAKNFNLADLHRAIKGHVIDKGKFVFTYLKK
Download sequence
Identical sequences Q6KIK7
WP_011264603.1.31918 267748.MMOB0830 gi|47458918|ref|YP_015780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]