SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011273585.1.58937 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011273585.1.58937
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Formyltransferase 4.32e-52
Family Formyltransferase 0.0000154
Further Details:      
 
Domain Number 2 Region: 213-313
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.53e-27
Family Post formyltransferase domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011273585.1.58937
Sequence length 327
Comment methionyl-tRNA formyltransferase [Corynebacterium jeikeium]; AA=GCF_000006605.1; RF=representative genome; TAX=306537; STAX=38289; NAME=Corynebacterium jeikeium K411; AL=Complete Genome; RT=Major
Sequence
MKIVFAGTPEPAAVALEHLIADERIEVVAVVTQPDAKRGRGRSLRPSKVAEVAEEAAIPT
YKWPSLKAGTESGDEARAVLGDLAAQGVTAAAVVAYGNLIPKDILDVFEHGWVNLHYSLL
PRWRGAAPVQAALAAGDETTGASIFRIEEGLDTGPVAAQLTQKIGLEDTADDLLASLTYA
GRELLADTLVAMDEGKAELSGQDDAQATHAPKIHPADAQIDWSQPAEVIQRVARAHTPAP
GAWTLLDGQRYKIGMLLPSDPADVAELGPGEVVASPKKVFVGTGTGPLEITRIQPPGKKM
MEAAAWARGQQELLAGRPTFSARETGE
Download sequence
Identical sequences Q4JVI0
WP_011273585.1.58937 gi|68536090|ref|YP_250795.1| 306537.jk1013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]