SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011277179.1.28054 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011277179.1.28054
Domain Number 1 Region: 91-167
Classification Level Classification E-value
Superfamily Single hybrid motif 1.57e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011277179.1.28054
Sequence length 167
Comment acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Sulfolobus acidocaldarius]; AA=GCF_001560205.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=GG12-C01-16; AL=Contig; RT=Major
Sequence
MKIIKVVTDQGDSYTFATEKRDNKDLMKAEGAEFEVEYLGAGWREGEHLVKVNGEVHTVS
IINGHLVIDNETLFKVDRVIEESLGEKVSFEELFKGKEGEIVSPLQGRIVQIRVKEGDAV
NKGQPLLSIEAMKSETVISAPKGGVVKKVLIKPGQGVKKGDLLLIIE
Download sequence
Identical sequences A0A0U3GUX2 M1J2V1 M1J9P5 Q4JC02
gi|449066301|ref|YP_007433383.1| gi|70606100|ref|YP_254970.1| gi|449068577|ref|YP_007435658.1| 330779.Saci_0261 WP_011277179.1.100797 WP_011277179.1.13097 WP_011277179.1.15291 WP_011277179.1.18585 WP_011277179.1.18739 WP_011277179.1.19907 WP_011277179.1.20267 WP_011277179.1.24072 WP_011277179.1.28054 WP_011277179.1.29213 WP_011277179.1.30898 WP_011277179.1.31299 WP_011277179.1.3283 WP_011277179.1.33024 WP_011277179.1.33782 WP_011277179.1.34459 WP_011277179.1.34536 WP_011277179.1.35781 WP_011277179.1.35800 WP_011277179.1.36276 WP_011277179.1.37881 WP_011277179.1.38112 WP_011277179.1.38253 WP_011277179.1.39308 WP_011277179.1.39398 WP_011277179.1.43265 WP_011277179.1.4394 WP_011277179.1.45682 WP_011277179.1.48356 WP_011277179.1.49892 WP_011277179.1.50721 WP_011277179.1.51246 WP_011277179.1.5150 WP_011277179.1.53520 WP_011277179.1.55288 WP_011277179.1.55517 WP_011277179.1.56706 WP_011277179.1.57256 WP_011277179.1.64117 WP_011277179.1.64360 WP_011277179.1.67449 WP_011277179.1.68798 WP_011277179.1.7301 WP_011277179.1.74875 WP_011277179.1.78046 WP_011277179.1.78998 WP_011277179.1.8042 WP_011277179.1.83345 WP_011277179.1.87279 WP_011277179.1.90653 WP_011277179.1.90680 WP_011277179.1.95134 WP_011277179.1.96274 WP_011277179.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]