SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011277217.1.74875 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011277217.1.74875
Domain Number 1 Region: 13-198
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.12e-59
Family FAD-linked oxidases, N-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 202-431
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 4.91e-46
Family D-lactate dehydrogenase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011277217.1.74875
Sequence length 440
Comment FAD-binding oxidoreductase [Sulfolobus acidocaldarius]; AA=GCF_001560125.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=GG12-C01-12; AL=Scaffold; RT=Major
Sequence
MIQGIEYEERVEREDFVGFKIRPKMIVYPRTEEDVVKIVNYARETKTPIVTWGAGTSLSG
HLICDGCILLDMKYMDNIIEINEIDWYARVQAGVNLERLDKELEKRGFFLPPDPASFFLC
SVGGATANSSGGMRGVKYGTFKDWVLALKVVLPNGKVVKIGEPFTKNRGGYDLVHLFVGS
EGTLGIITEIWFKIIPLPRRKKYTILAYTDSLEDTAEVIVSLRKNKIMPELAEFVDYQVI
NALNKHLNAGLEEVRDGGALIISVEEDYLEELKKILGNKKYVVAEGEEAERIYSLRAQAA
IALKAEGKTMYIEDIVVPVSRLVEAIRRLREIERAYNVKMPTIAHIGDGNLHPNVIYDDP
KVGKKVFEEVAKVAIELGGSVSGEHGIGIQKAKLLGDQIISHNGKEVLELMKRIKDLFDP
YDIMNPNKYVELAYKLSENR
Download sequence
Identical sequences A0A0U3HES9 M1ISC0 M1IZB2 Q4JBW4
gi|70606138|ref|YP_255008.1| 330779.Saci_0299 WP_011277217.1.100797 WP_011277217.1.13097 WP_011277217.1.15291 WP_011277217.1.18585 WP_011277217.1.18739 WP_011277217.1.19907 WP_011277217.1.20267 WP_011277217.1.24072 WP_011277217.1.28054 WP_011277217.1.29213 WP_011277217.1.30898 WP_011277217.1.31299 WP_011277217.1.3283 WP_011277217.1.33024 WP_011277217.1.33782 WP_011277217.1.34459 WP_011277217.1.34536 WP_011277217.1.35781 WP_011277217.1.35800 WP_011277217.1.36276 WP_011277217.1.37881 WP_011277217.1.38112 WP_011277217.1.38253 WP_011277217.1.39308 WP_011277217.1.39398 WP_011277217.1.43265 WP_011277217.1.4394 WP_011277217.1.45682 WP_011277217.1.48356 WP_011277217.1.49892 WP_011277217.1.50721 WP_011277217.1.51246 WP_011277217.1.5150 WP_011277217.1.53520 WP_011277217.1.55288 WP_011277217.1.55517 WP_011277217.1.56706 WP_011277217.1.57256 WP_011277217.1.64117 WP_011277217.1.64360 WP_011277217.1.67449 WP_011277217.1.68798 WP_011277217.1.7301 WP_011277217.1.74875 WP_011277217.1.78046 WP_011277217.1.78998 WP_011277217.1.8042 WP_011277217.1.83345 WP_011277217.1.87279 WP_011277217.1.90653 WP_011277217.1.90680 WP_011277217.1.95134 WP_011277217.1.96274 WP_011277217.1.97501 gi|449066340|ref|YP_007433422.1| gi|449068616|ref|YP_007435697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]