SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011278218.1.31299 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011278218.1.31299
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Folate-binding domain 9.1e-62
Family Aminomethyltransferase folate-binding domain 0.00000792
Further Details:      
 
Domain Number 2 Region: 257-349
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 8.5e-21
Family Aminomethyltransferase beta-barrel domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011278218.1.31299
Sequence length 351
Comment glycine cleavage system protein T [Sulfolobus acidocaldarius]; AA=GCF_001560435.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=NG05B_C06_04; AL=Contig; RT=Major
Sequence
MFSSPLLDIETKLNADIGEFANWKMPMKYTSYQDEHLLVRTSVAFFDISHMGRLKVSGNQ
NELEFLVSKEISKNKPNSMIGPTAFLNDKGGFEDDVMIYKVSENEFLIVTNAINREKIIN
WIGKNSGLNVEDLTFKYGMLAIQGRNVWNFIEKAEVKPLEFILNTKFLGENVFLLSRSGW
TGEDGLEVWADANTLTSIIQKLLKLGIKPAGLIARDSLRQEMGYVLYGEDIDSNITPVEA
RYWVFSLDKDFIGKEKIMEHVENGVNRIRLGFKLKKDDRLLPRKDYKIKSPLGSRDVGYV
TSSTFSPYLNRVIGMGYIKPEYAYIGYELAIDIRGKQVKAKISDFPLINTR
Download sequence
Identical sequences A0A0U3H8C5 M1I5C7 M1IYM5 Q4J914
WP_011278218.1.100797 WP_011278218.1.13097 WP_011278218.1.15291 WP_011278218.1.18585 WP_011278218.1.18739 WP_011278218.1.19907 WP_011278218.1.20267 WP_011278218.1.24072 WP_011278218.1.28054 WP_011278218.1.29213 WP_011278218.1.30898 WP_011278218.1.31299 WP_011278218.1.3283 WP_011278218.1.33024 WP_011278218.1.33782 WP_011278218.1.34459 WP_011278218.1.34536 WP_011278218.1.35781 WP_011278218.1.35800 WP_011278218.1.36276 WP_011278218.1.37881 WP_011278218.1.38112 WP_011278218.1.38253 WP_011278218.1.39308 WP_011278218.1.39398 WP_011278218.1.43265 WP_011278218.1.4394 WP_011278218.1.45682 WP_011278218.1.48356 WP_011278218.1.49892 WP_011278218.1.50721 WP_011278218.1.51246 WP_011278218.1.5150 WP_011278218.1.53520 WP_011278218.1.55288 WP_011278218.1.55517 WP_011278218.1.56706 WP_011278218.1.57256 WP_011278218.1.64117 WP_011278218.1.64360 WP_011278218.1.67449 WP_011278218.1.68798 WP_011278218.1.7301 WP_011278218.1.74875 WP_011278218.1.78046 WP_011278218.1.78998 WP_011278218.1.8042 WP_011278218.1.83345 WP_011278218.1.87279 WP_011278218.1.90653 WP_011278218.1.90680 WP_011278218.1.95134 WP_011278218.1.96274 WP_011278218.1.97501 gi|449067379|ref|YP_007434461.1| 330779.Saci_1383 gi|70607139|ref|YP_256009.1| gi|449069649|ref|YP_007436730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]