SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011278363.1.5150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011278363.1.5150
Domain Number 1 Region: 180-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.04e-78
Family RecA protein-like (ATPase-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 450-533
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 3.77e-20
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0028
Further Details:      
 
Domain Number 3 Region: 3-72
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000000419
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0034
Further Details:      
 
Weak hits

Sequence:  WP_011278363.1.5150
Domain Number - Region: 115-180
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0432
Family Biotinyl/lipoyl-carrier proteins and domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011278363.1.5150
Sequence length 592
Comment ATP synthase subunit A [Sulfolobus acidocaldarius]; AA=GCF_001560035.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=GG12-C01-05; AL=Contig; RT=Major
Sequence
MAGEGRVVRVNGPLVVADGMRNAQMFEVVEVGELRLVGEITRIEGDRAYIQVYEATDGIK
PGEKAYRTGSLLSVELGPGLMGGIFDGLQRPLDRIAESVKSPFVTRGVKVPALERNKKWH
VIPVAKKGDKVSPGDIIAKVNETDLIEHRIIVPPNVHGTLKEISPEGDYTVEDVIARVDM
EGDVKELKLYQRWPVRIPRPFKEKLEPTEPLLTGTRVVDTIFPIAKGGTAAIPGPFGSGK
TVTLQSLAKWSEAKVVIYVGCGERGNEMTDELRQFPKLKDPWTGKPLLQRTILVANTSNM
PVAARESSIYVGVTMAEYFRDQGYDVLLVADSTSRWAEALRELGGRMEEMPAEEGFPSYL
PSRLAEYYERAGRVIALGKPERFGSVSIASAVSPPGGDFTEPVTSNTLRFVRVFWPLDVS
LAQARHYPAINWIQGFSAYVDLVASWWHKNVDPTWFEMRSVLVKILLREDELRQIVRLVG
PESLSDKDKLILEASKLIRDAFLKQNAFDDIDAFSSPQKQAKIMRLIYDFYTNASQLLDK
GLTLKKILEKVGSFEPDIVRVKYTVKNDELNKIDELDNKLKEAFDSLLKEVA
Download sequence
Identical sequences A0A0U3H5V3 M1IWA7 M1J2R4 Q4J8L9
gi|449067527|ref|YP_007434609.1| WP_011278363.1.100797 WP_011278363.1.13097 WP_011278363.1.15291 WP_011278363.1.18585 WP_011278363.1.18739 WP_011278363.1.19907 WP_011278363.1.20267 WP_011278363.1.24072 WP_011278363.1.28054 WP_011278363.1.29213 WP_011278363.1.30898 WP_011278363.1.31299 WP_011278363.1.3283 WP_011278363.1.33024 WP_011278363.1.33782 WP_011278363.1.34459 WP_011278363.1.34536 WP_011278363.1.35781 WP_011278363.1.35800 WP_011278363.1.36276 WP_011278363.1.37881 WP_011278363.1.38112 WP_011278363.1.38253 WP_011278363.1.39308 WP_011278363.1.39398 WP_011278363.1.43265 WP_011278363.1.4394 WP_011278363.1.45682 WP_011278363.1.48356 WP_011278363.1.49892 WP_011278363.1.50721 WP_011278363.1.51246 WP_011278363.1.5150 WP_011278363.1.55288 WP_011278363.1.55517 WP_011278363.1.56706 WP_011278363.1.57256 WP_011278363.1.64117 WP_011278363.1.64360 WP_011278363.1.67449 WP_011278363.1.68798 WP_011278363.1.7301 WP_011278363.1.74875 WP_011278363.1.78046 WP_011278363.1.78998 WP_011278363.1.8042 WP_011278363.1.83345 WP_011278363.1.87279 WP_011278363.1.90653 WP_011278363.1.90680 WP_011278363.1.95134 WP_011278363.1.96274 WP_011278363.1.97501 330779.Saci_1548 gi|70607284|ref|YP_256154.1| gi|449069801|ref|YP_007436882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]