SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011278627.1.68798 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011278627.1.68798
Domain Number 1 Region: 172-269
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000183
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 
Weak hits

Sequence:  WP_011278627.1.68798
Domain Number - Region: 34-131
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000111
Family Multidrug resistance efflux transporter EmrE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011278627.1.68798
Sequence length 271
Comment hypothetical protein [Sulfolobus acidocaldarius]; AA=GCF_000012285.1; RF=representative genome; TAX=330779; STAX=2285; NAME=Sulfolobus acidocaldarius DSM 639; strain=DSM 639; AL=Complete Genome; RT=Major
Sequence
MRERALLFFGGVAFGTAAIFVKFCSITPPYITLFRFLFAGLVLLLIGRAIRKQGNNKNSH
NNPISLRKLVLPSLFLSLHMVLFVFSVFLTTIAASTILVSTSPIFAMIFKRRVDLFVILA
ILGIVIMNLNSPFGSIVGNLMAVISALSFALYTYFLSKIQYDFFTVTPRIYIISSAFMVP
VLPFFSMGNFNLETLMAILGLVFIPTIIGHGSVIYSANKVPISLVTSAELIEPVVATLLA
FILFSQVPSLEEIVGGVLTLISLFFAFRRRD
Download sequence
Identical sequences A0A0U3H762 M1IEW7 M1J7B3 Q4J7V6
gi|449070075|ref|YP_007437156.1| GO.5167 gi|449067801|ref|YP_007434883.1| gi|70607548|ref|YP_256418.1| 330779.Saci_1819 WP_011278627.1.100797 WP_011278627.1.13097 WP_011278627.1.15291 WP_011278627.1.18739 WP_011278627.1.20267 WP_011278627.1.24072 WP_011278627.1.28054 WP_011278627.1.29213 WP_011278627.1.30898 WP_011278627.1.31299 WP_011278627.1.3283 WP_011278627.1.33024 WP_011278627.1.33782 WP_011278627.1.34459 WP_011278627.1.34536 WP_011278627.1.35781 WP_011278627.1.35800 WP_011278627.1.36276 WP_011278627.1.37881 WP_011278627.1.38112 WP_011278627.1.38253 WP_011278627.1.39398 WP_011278627.1.43265 WP_011278627.1.4394 WP_011278627.1.45682 WP_011278627.1.49892 WP_011278627.1.50721 WP_011278627.1.51246 WP_011278627.1.5150 WP_011278627.1.53520 WP_011278627.1.55288 WP_011278627.1.55517 WP_011278627.1.56706 WP_011278627.1.57256 WP_011278627.1.64117 WP_011278627.1.64360 WP_011278627.1.67449 WP_011278627.1.68798 WP_011278627.1.7301 WP_011278627.1.74875 WP_011278627.1.78046 WP_011278627.1.78998 WP_011278627.1.8042 WP_011278627.1.83345 WP_011278627.1.87279 WP_011278627.1.90653 WP_011278627.1.90680 WP_011278627.1.95134 WP_011278627.1.96274 WP_011278627.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]