SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011283688.1.35279 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011283688.1.35279
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily L21p-like 6.54e-31
Family Ribosomal protein L21p 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011283688.1.35279
Sequence length 100
Comment MULTISPECIES: 50S ribosomal protein L21 [Mycoplasma]; AA=GCF_000008245.1; RF=na; TAX=262723; STAX=2109; NAME=Mycoplasma synoviae 53; strain=53; AL=Complete Genome; RT=Major
Sequence
MFAIIETGGKQILVKEGDSIYVEKLEGQEKSEVKFDKVLAVNDVFGKPYVTGAVVHGTIE
KQGKAKKIVVYRHNPKSTHKRKLGHRQPYTLVKITKIKGK
Download sequence
Identical sequences A0A0E3H7X5 A0A2H4CDG8 Q4A5L2
gi|161611233|ref|YP_278670.2| 262723.MS53_0551 WP_011283688.1.100025 WP_011283688.1.28789 WP_011283688.1.35279 WP_011283688.1.65622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]