SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011285463.1.65209 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011285463.1.65209
Domain Number 1 Region: 17-380
Classification Level Classification E-value
Superfamily SIS domain 8.25e-50
Family double-SIS domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011285463.1.65209
Sequence length 399
Comment tagatose-6-phosphate ketose [Streptococcus pyogenes]; AA=GCF_000993765.1; RF=na; TAX=1314; STAX=1314; NAME=Streptococcus pyogenes; strain=AP1; AL=Complete Genome; RT=Major
Sequence
MFTKTQEALEALGAAITTKEIKQEPRLWQETMTFFEETRDSLDSFLKRVCNSANRNNVHV
IFTGAGTSEYIGNTICPYLKKVGNRQRYLFESVASTDLVAAPDYYLVEEETVLLVSFARS
GNSPESVAAVNLVNQLVPNSYHLTITCAKDGELAKKAQQDERSYLYLMPEDANDAGFAMT
GSFTCMMLAALLIFDDANSIAQKEAYVTDMILAGQAVIDQERRLQELADLGFERLVYLGS
AGLAKLTQEAQLKMLELTAGQVATLYESSMGFRHGPKSFINDRTLVIGFVNNDAYVRQYD
LDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLLPDAYLAFPMILVAQTLALLT
AVTLGNSPDTPSATGTVNRVVKGVTIHPYPTSSRQCNKA
Download sequence
Identical sequences A0A2H1X5N2 J7M5C6
gi|71910358|ref|YP_281908.1| 293653.M5005_Spy_0545 gi|470200700|ref|YP_007587129.1| gi|410680224|ref|YP_006932626.1| WP_011285463.1.100902 WP_011285463.1.11642 WP_011285463.1.11796 WP_011285463.1.134 WP_011285463.1.13723 WP_011285463.1.14556 WP_011285463.1.16107 WP_011285463.1.19971 WP_011285463.1.20187 WP_011285463.1.20282 WP_011285463.1.2074 WP_011285463.1.23366 WP_011285463.1.26529 WP_011285463.1.26802 WP_011285463.1.2743 WP_011285463.1.27781 WP_011285463.1.28087 WP_011285463.1.28592 WP_011285463.1.29629 WP_011285463.1.33081 WP_011285463.1.34147 WP_011285463.1.34964 WP_011285463.1.35535 WP_011285463.1.36083 WP_011285463.1.39774 WP_011285463.1.4053 WP_011285463.1.41814 WP_011285463.1.42026 WP_011285463.1.43805 WP_011285463.1.44357 WP_011285463.1.45044 WP_011285463.1.45784 WP_011285463.1.46419 WP_011285463.1.47538 WP_011285463.1.51065 WP_011285463.1.52458 WP_011285463.1.53400 WP_011285463.1.56127 WP_011285463.1.56455 WP_011285463.1.57070 WP_011285463.1.60378 WP_011285463.1.62427 WP_011285463.1.64314 WP_011285463.1.65209 WP_011285463.1.68191 WP_011285463.1.69206 WP_011285463.1.72435 WP_011285463.1.74376 WP_011285463.1.74773 WP_011285463.1.75380 WP_011285463.1.75397 WP_011285463.1.77086 WP_011285463.1.77451 WP_011285463.1.8063 WP_011285463.1.82325 WP_011285463.1.83959 WP_011285463.1.88255 WP_011285463.1.88809 WP_011285463.1.88958 WP_011285463.1.93188 WP_011285463.1.93335 WP_011285463.1.93979 WP_011285463.1.95717 WP_011285463.1.96175 WP_011285463.1.96338 WP_011285463.1.96528 WP_011285463.1.96685 WP_011285463.1.96787 WP_011285463.1.9843 WP_011285463.1.99902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]