SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011286337.1.67134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011286337.1.67134
Domain Number 1 Region: 449-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.55e-16
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011286337.1.67134
Sequence length 563
Comment sodium-independent anion transporter [Dechloromonas aromatica]; AA=GCF_000012425.1; RF=representative genome; TAX=159087; STAX=259537; NAME=Dechloromonas aromatica RCB; strain=RCB; AL=Complete Genome; RT=Major
Sequence
MKIAFHPKLLDCLPTYNRTQLGQDIAAGITVGVLALPLAMAFAIASGCSPTAGIWTAIVA
GLITSLLGGSRVQIGGPTGAFIPIIYGIVAIHGFSNLLGATMLAGVFLLAMGLARMGQLI
RFIPVTVVIGFTNGIAVVIFLAQIKDFFGLKIESLPAEFFHRIKTLAAYADTVDLPTLGL
ASACFIFLLSYNWLAQRIAILRRAPGPLAVLVVGTLVSYIFDLPVETIGSRFHGIPQELP
HFGLPDLSIHDFGQLISPAITIALLGAIESLLSARVADGQIDDRHDPNQELVAQGLANIV
APLFGGFAATGAIARTTTNVKSGGRTPIAGIIHAFVLLGVVLIAAPLASYVPLATLSAIV
MVVAINMGEWHEFRELQRYTYNYRIILLATFIVTVLFDLTIAVELGMVLACLFFIYRMSE
LTRVERRPLREEASEPQFLYPDGTMRVAAWQLFGSLFFGAVNKLEALLDPAAGHPEVVIL
DMTQLIQLDTTGLEGLESLLDKLKKRGCTLLVCGLNSQPGSLLYRSGFVDHLGDDNVCPD
LSSALQRAYILLPNLMGSHEEDY
Download sequence
Identical sequences Q47IK3
gi|71906211|ref|YP_283798.1| WP_011286337.1.67134 159087.Daro_0571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]