SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011291320.1.82272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011291320.1.82272
Domain Number 1 Region: 453-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011291320.1.82272
Sequence length 597
Comment MFS transporter [Thermobifida fusca]; AA=GCF_000012405.1; RF=representative genome; TAX=269800; STAX=2021; NAME=Thermobifida fusca YX; strain=YX; AL=Complete Genome; RT=Major
Sequence
MNLPVLSRDSALRPVLDRFRVMIPARADLARMRHAPGRNLLAGVTVAVVALPLALGFGIS
SGLGAQAGLVTAIVAGALAAFFGGSNLQVSGPTGAMTVVLVPIVAQHGPSGVLTVGLMAG
LMLVLLALLRAGRYVRYIPASVVEGFTIGIAAVIALQQVPAALGVPVPEGDRVLVVAWQA
VLDFAAHPEWTAVAIALGVVVVMLVGARWRPTVPFSLMAVVLATVLVEVTPLHAERIGDL
PAGLPAPSLGFLDLSQVGTLVAPAAAVAALAALESLLSATVADGMSVNQRHDPDRELFGQ
GVANIAAPLFGGVPATAAIARTAVNVRSGASSRLAAITHALVLAGIVYLAAPLVERIPLA
ALAGVLLATAVRMVEVGSVRAMVRATRSDGVVLVLTAVVTLTVDLVVAVLVGMLVAGALA
LASLARNASLDQEELARHLPPGDHTEEERALLAKHIVAYRIDGPLFFAAAHRFLLELSEV
ADVRVVILRMARVSTIDATGAQVLGDAVDRLQARGITVMMSGLRPGQLRPLESLGTLPRL
REAGCVFETTPEAIQAALTMLHHAGVIPSSLRSAEAAPQGAAVLSSPGHQAPAPGKA
Download sequence
Identical sequences Q47RK6
269800.Tfu_0873 WP_011291320.1.46431 WP_011291320.1.72373 WP_011291320.1.82272 gi|72161277|ref|YP_288934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]