SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011306259.1.74748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011306259.1.74748
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.53e-40
Family Transposase IS200-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011306259.1.74748
Sequence length 149
Comment IS200/IS605 family transposase [Methanosarcina barkeri]; AA=GCF_000969985.1; RF=na; TAX=1434109; STAX=2208; NAME=Methanosarcina barkeri str. Wiesmoor; strain=Wiesmoor; AL=Complete Genome; RT=Major
Sequence
MELRHANHCVYKIRYHMVFCMKYRKKLLLDAEIISFLKTICFGIGERYCFEFDAIGTDGD
HVHLFVGAEPKYSPSRVMQIIKSITARQIFKQYPEIKKQLWGSELWSDGGYIGTVGDGTT
SDVIKSYIENQGNQEEKEAYKQMKIIDFQ
Download sequence
Identical sequences A0A0E3QQX2 Q469K8
gi|73668777|ref|YP_304792.1| gi|73669999|ref|YP_306014.1| 269797.Mbar_A1248 269797.Mbar_A2521 WP_011306259.1.36239 WP_011306259.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]