SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011306781.1.36239 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011306781.1.36239
Domain Number 1 Region: 21-340,388-422
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.33e-48
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 704-875
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.39e-30
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 3 Region: 425-509
Classification Level Classification E-value
Superfamily PKD domain 3.79e-25
Family PKD domain 0.00025
Further Details:      
 
Domain Number 4 Region: 994-1081
Classification Level Classification E-value
Superfamily PKD domain 4.58e-25
Family PKD domain 0.00027
Further Details:      
 
Domain Number 5 Region: 517-598
Classification Level Classification E-value
Superfamily PKD domain 9.94e-25
Family PKD domain 0.00027
Further Details:      
 
Domain Number 6 Region: 877-1030
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-19
Family Quinoprotein alcohol dehydrogenase-like 0.0037
Further Details:      
 
Domain Number 7 Region: 609-744
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.14e-16
Family Quinoprotein alcohol dehydrogenase-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011306781.1.36239
Sequence length 1328
Comment cell surface protein [Methanosarcina barkeri]; AA=GCF_000195895.1; RF=na; TAX=269797; STAX=2208; NAME=Methanosarcina barkeri str. Fusaro; strain=Fusaro; AL=Complete Genome; RT=Major
Sequence
MNKNTLKIFISCLLLFLVTATMPALGSDWTQFQKDVYNAGVTTDRAPITDPTNYLLSWNY
SLGGNIDSAPLVAGEMMYVLAGNNHIYAFDRTTGSLAWEQSTSGSAGFTIGSAAVGNGII
FVPTSDGKIFAFDAKTGTLKWNKTVGSGKQLDTPITYSEGKIYFGEAMGGHKYYCYDEEG
NEVWSRTSTTQTSTQGSYYWAGAAVIGNNLVYGDDDGHIISVNKDTGADISEIDVSEEFG
VTCGKIRSSVLYVEELKRIYFTSTGGYCFAIGFNPADGTFNTNDKHSEKVWYSTTTPTYY
KGRIYIGTGAQMYSAGKGVYCLDSDLSGVIWNYPADVVQSSPALSTYYDDGDGEVYIYFT
VNNATGGVYCLKDLAGSTSPELVWSYKDAKKTQYSLQGVAISDGWIYFGADKKYVFGLTT
KDSQASTAPSASFSGSPLSGNSPLEVQFTDKSTGAPTSWAWDFDNDGTVDSKEQNPSNTY
NAVGNYTVSLTVANAEGSDSEVKTNYITVSESSTSTELVAAFTADVTSGTAPLTVDFTDK
STGAPTSWAWDFDNDGTVDSKEQNPSHIYNDTGSYTVKLTVSNGNDSDAKEIQDMIKVTE
EEQEQPVTSEDSWYQFHKDAQHSGYTSSTAPDSANLAWTAEPLNDTYSLVPSSSVAIAEG
KVFGLCNGPTDEYGNPLTSYGQLVAFDENTGQEVWNVTIEAPEWGSWSSPAYDSGKVFAS
AGKQTYCINASTGEVIWTFHNPTDLASCDGGPSIGDGKVFVSDWDGGNYYCLDESNGGLL
WTFKVDGAYAQGTPAYKDGKVYLTCWSSTNAVYCVNAETGEMIWKNDGFENGPCGSVTIT
DEGLYVTVFGFGTSDGIYKLDLTDGSVLWGRSDVSPSDSTPTVLDGKVYLSTGTSGYSEL
KTYCLDASDGQSLWETNASDNIGDWACSVAVADGKVFTGGAASGLFTGSSTLYAFDAETG
SQVWSYEGCGCSPAIADGMVFSIGSGKIYAFKETQGSLLEAKFSSNMSTGKAPLTVSFTD
ESTGEGITSWDWDFDNDGTIDSTEQNPIYTYNATGTYTVNLTVSNEEGSDSEVKTGYITV
AESSAQKDQPDLVVSALNPPSKITANNLCNIGATINNTGVGNAGAFNVTLSVNGTVVDTQ
SVSGLASGSSEVVSFSWTPIESGDYIIAVNADAENLVTESDETNNVLEDYITVTESSGSQ
DNNSSSQGNGSSSTVCLTVKIAPVVSIEVSPSALDFGELSPGKTSESQNLIIKNTGSCDV
NVTTKVSDSTGDSLFSQGLLLDSQLWNKYLKVIGKNTQENAAVSLQVSSDYAESGTKKGE
ITFWAEAV
Download sequence
Identical sequences Q46BK7
269797.Mbar_A1794 gi|73669300|ref|YP_305315.1| WP_011306781.1.36239 WP_011306781.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]