SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011306785.1.74748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011306785.1.74748
Domain Number 1 Region: 601-964
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.02e-50
Family Quinoprotein alcohol dehydrogenase-like 0.0079
Further Details:      
 
Domain Number 2 Region: 1134-1217
Classification Level Classification E-value
Superfamily PKD domain 8.24e-31
Family PKD domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1218-1298
Classification Level Classification E-value
Superfamily PKD domain 1.07e-30
Family PKD domain 0.00034
Further Details:      
 
Domain Number 4 Region: 968-1049
Classification Level Classification E-value
Superfamily PKD domain 1.24e-30
Family PKD domain 0.00018
Further Details:      
 
Domain Number 5 Region: 1056-1135
Classification Level Classification E-value
Superfamily PKD domain 3.14e-30
Family PKD domain 0.00039
Further Details:      
 
Domain Number 6 Region: 12-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.02e-29
Family Pectin methylesterase 0.033
Further Details:      
 
Domain Number 7 Region: 335-421
Classification Level Classification E-value
Superfamily PKD domain 2.62e-27
Family PKD domain 0.00032
Further Details:      
 
Domain Number 8 Region: 512-596
Classification Level Classification E-value
Superfamily PKD domain 1.83e-22
Family PKD domain 0.00029
Further Details:      
 
Domain Number 9 Region: 424-508
Classification Level Classification E-value
Superfamily PKD domain 2.09e-22
Family PKD domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011306785.1.74748
Sequence length 1300
Comment cell surface protein [Methanosarcina barkeri]; AA=GCF_000969985.1; RF=na; TAX=1434109; STAX=2208; NAME=Methanosarcina barkeri str. Wiesmoor; strain=Wiesmoor; AL=Complete Genome; RT=Major
Sequence
MKKIHYVCMVALLSTMMLAVAPASATTWDVSTVSELQNAAANAGEGDTIFVHNGNYTLTS
TLYLYKSNITFTGESKEGVVLLRDNDFITIGSNGGPAPGCIVENMTLLGDITSTSGVFGI
SVRSPDCTLRNLILRDIRDCAVISSNSEDCSGLIISNCTFDNSGTENFAISILATNSIIE
NNVIKNNQYAYGPLCVQAQNVTVSNNLFMNNPYAFYLVYADNSLVSGNNMVSTGNILIYD
PGEAIVWQLNNFSESIVSNEWAGPLPSVTYWNSTEPVEYTYNGATYTGYPGNYWGAAYTG
TDADGNGIGDTPYEVPGGLGTDYSPLISPKENYEILEPPVANFNAAPLSGNVPLAVQFTD
QSTGSGISSWTWDFDGDGNVDSTEQNPSHTYNSTGTYTVNLTVTGQLGSDSKTKADCITV
REPAEPPIADFSADPLSGPIPLEVQFTDLSTGEGIDSWSWDFDSNGTVDSTEQNPTFTYS
EIGNYTVTLNVTGTGGSDSKVKADYIVSEEAEPAFPTAGFSASARDGAVPFTVKFTDSSE
NTIDWAWDFDGDGNVDSTEQNPLYTYYTEGNYTVKLTASNGNGSDVLEIPDMITVASERP
APPDDSWYQFHGKVDHLGYSENGPKTNRTEWISESVTDAIGSSSPVVAEGKIFVICGGAE
IEEETTGIVQLVALNESTGDIAWNTSIPETVYGSWASPAYDDGMVFTATGPELGCYNAET
GEKIWCFNDTVGTLGAVNGGPAIADGMVIFSDWDGHHYYCLDEYTGYLLWSFVVVGDAQS
VPAYADGKFYLTGWTYTQGYAYCVDATTGEQLWTINVERSFCGSPAYKDGVLYLTTYNFS
GDGDLFALNATDGSIIWQQTVQRTDSTPALAYGNVYVSGGCSGFSDKETYCFNATTGEPV
WSIPSIGDWTWSVAVADGLAYVGGYALDAFTGDVVWNSPYGGGTPALSDGMFFSIGSSKK
VYAFKDSLSSPIANFSADMTSGNAPLTVNFTDQSTGTPTSWLWDFGDGTNVTEQNPAHTY
TATGTYTVNLTVSNEDGSDSEVKTGYIKVSSQSSAKPVAAFSASPTSGKTPLNVTFTDTS
TGSPTSWFWNFGDGSKSFLQNPVHKYSKAGTYTVNLTVKNAKGKNTVTKTQYIKVITKPV
ANFSASPTSGKAPLKVTFTDTSTGIPAKWRWDFGDGAKSFQQNPIHKYSKAGTYTVNLTV
KNAKGKNTVTKTEYIKVITKPVANFSASPTSGKAPLKVTFTDTSTGIPAKWRWDFGDGSD
SFHQNPIHKYSKAGTYTVNLTVKNVKGSNTVTKTEYIKIT
Download sequence
Identical sequences A0A0E3LM07 Q46BK3
269797.Mbar_A1798 gi|73669304|ref|YP_305319.1| WP_011306785.1.36239 WP_011306785.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]