SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011306971.1.74748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011306971.1.74748
Domain Number 1 Region: 48-361
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.2e-31
Family Quinoprotein alcohol dehydrogenase-like 0.0046
Further Details:      
 
Domain Number 2 Region: 985-1069
Classification Level Classification E-value
Superfamily PKD domain 3.53e-24
Family PKD domain 0.00026
Further Details:      
 
Domain Number 3 Region: 879-1036
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-24
Family Quinoprotein alcohol dehydrogenase-like 0.0014
Further Details:      
 
Domain Number 4 Region: 743-880
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-22
Family Quinoprotein alcohol dehydrogenase-like 0.003
Further Details:      
 
Domain Number 5 Region: 454-535
Classification Level Classification E-value
Superfamily PKD domain 3.14e-21
Family PKD domain 0.0011
Further Details:      
 
Domain Number 6 Region: 533-621
Classification Level Classification E-value
Superfamily PKD domain 1.7e-20
Family PKD domain 0.00046
Further Details:      
 
Domain Number 7 Region: 625-733
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000419
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011306971.1.74748
Sequence length 1311
Comment cell surface protein [Methanosarcina barkeri]; AA=GCF_000969985.1; RF=na; TAX=1434109; STAX=2208; NAME=Methanosarcina barkeri str. Wiesmoor; strain=Wiesmoor; AL=Complete Genome; RT=Major
Sequence
MKKMKSKIPILCTILLLMMAIIPASAMTSDWLLGGGSSGGEGGETPVAVAPMPDSSDTVM
FKNNLYHTGVTSQAGPIDDPDLIWSTHTGYMNTDPLVLDDLLVSVCSHNISVHNITTGEY
IWNTVTSGENLGPACYGNGTIFYPESSRGKLSAYDIRNGDLLWNITGLGGSYSQLNTPVV
YEDHRIYFGTCYGNPSAYYCYYDNGTQCWSYEGDGYYWAGAAVIGDYLVFGGEDMNLTSL
NKNTGELVDEINVSAVFSIPNSGSQIQSSVSYDENSSRCYFTTTSGYCCVIGFDKSTGKF
VRTDKASHSIGPSTSTPAIYNGRLYVGVGKMFKSGGEPCLFCLNASDLSEIWKYTANGII
QSSPTVSTYYENSTGDIYIYFTTNVKNGTVYCLRDNASNTDAMEVWHWTPPESMQQYVLG
GAVIKQGYLFFGNNEWKGAAGCTFALKRSDSNPVVADFSAENTFGKAPLNVSFTDESTGY
GIDGWLWDFGDNTTSNETNPYHIYENNGLYTVSLTVIGSGSSNTSTRTGLINVTDQITPV
ADFSYSVSGTQSPVSVEFTDTSYNTNSATTWSWDFGDNTTSNLQNPTHQYAEDGTYSVTL
TVSSQYESNTVKKSGIIIVEPWNVPEWATNDSWPQFQKDAQHSGFSEGSAPSTATRLWVS
DNIGAVRSSSVAVSGGRIFVNCNDNDTGMSVIRSLNQQTGAVLTDHGEADGGGFYGSWSS
PVYDDGKVWCGLNNYPEGTTYNSVNGGTMVADGKVFSSNWKGNQYFCFEESTGEELWNFS
APVSSYAQSCPAYKDDKVYVLYWHGFSDDGENLVYCLNADTGEEIWKHANISSNPCGSPM
ITDDAVYFTTYNPEGESAQLYALNITDGSVLWSNTSITGTDSTPAYAYGNIYVSSGYSRY
ITYCFNATTGELVWETDPKDNIGFWTCSPAAADGKVYVGTGGSGLVCLDAYTGELIWQDK
GGGSTPAIVDGVVYSVGKDGKVYAYSSSQSVADFTANTISGEAPLTVNFTDQSNGAESWS
WDFDGDGNVDSTEQNPAHTYTAADNYTVNLTVTNAEGSNSKVKTDYITVTDSSTLGDQPD
LIVSSIIPPSGVNANTSCNIGATINNIGASDAVIFNATLSVNGAVVDTSTVSGIVSGSST
AVNFSWKPVKSGDYSVKVSADAGDVIAESNETNNELTDSITVEEASSGSQKGSSSVSLNV
TIIPVISLEVSPSALDFGELYPGKNSELQYLNLKNRGSCDVNVTAIVCDFSAGDELFSQG
LMLDSQLWDNYWKVVGRNSQENTSVALQVPTDYAGSGNKKGTITFWAEAAE
Download sequence
Identical sequences A0A0E3QPT9 Q46B17
gi|73669490|ref|YP_305505.1| 269797.Mbar_A1991 WP_011306971.1.36239 WP_011306971.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]