SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011306973.1.36239 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011306973.1.36239
Domain Number 1 Region: 527-923
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.11e-59
Family Quinoprotein alcohol dehydrogenase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1339-1632
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.62e-39
Family Quinoprotein alcohol dehydrogenase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 347-438
Classification Level Classification E-value
Superfamily PKD domain 6.15e-31
Family PKD domain 0.00024
Further Details:      
 
Domain Number 4 Region: 13-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.83e-30
Family Pectin methylesterase 0.034
Further Details:      
 
Domain Number 5 Region: 1805-1886
Classification Level Classification E-value
Superfamily PKD domain 4.97e-30
Family PKD domain 0.00035
Further Details:      
 
Domain Number 6 Region: 1725-1804
Classification Level Classification E-value
Superfamily PKD domain 1.44e-29
Family PKD domain 0.00035
Further Details:      
 
Domain Number 7 Region: 1887-1967
Classification Level Classification E-value
Superfamily PKD domain 3.92e-29
Family PKD domain 0.00029
Further Details:      
 
Domain Number 8 Region: 1636-1718
Classification Level Classification E-value
Superfamily PKD domain 1.44e-27
Family PKD domain 0.00021
Further Details:      
 
Domain Number 9 Region: 1021-1229
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.93e-27
Family Pectin methylesterase 0.023
Further Details:      
 
Domain Number 10 Region: 445-527
Classification Level Classification E-value
Superfamily PKD domain 6.28e-26
Family PKD domain 0.00027
Further Details:      
 
Domain Number 11 Region: 930-1013
Classification Level Classification E-value
Superfamily PKD domain 1.44e-23
Family PKD domain 0.00032
Further Details:      
 
Domain Number 12 Region: 1247-1375
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-17
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011306973.1.36239
Sequence length 1969
Comment cell surface protein [Methanosarcina barkeri]; AA=GCF_000195895.1; RF=na; TAX=269797; STAX=2208; NAME=Methanosarcina barkeri str. Fusaro; strain=Fusaro; AL=Complete Genome; RT=Major
Sequence
MKTIYYIFIIVILSSIMVVSPASAKTWNVDTSQEILDALDNCADGDTIFVMNGVYEIGDN
KIIKVPNLTFKGESRDGVIIKSNSQILGVGGSNGAAPNCVIENFTGMLKTAGQKPNGITI
YQSPGCIIQNVAINVPMSPISINANDCIVRNCVFDDCSDSGISIGGKNNTFKNNIVSNIT
SAFSLYIPNTATENIIENNIFNNCNPVYLRGENSTVANNTFLNDIGAAIALYSTTAKNNT
IVRNNIVSNGIAINVVKNAGDGNKIYLNNFANTSGMSGTPPAITYWNSTEPMEYTYNGTT
HTGYLGNYWGTAYSGSDSDGNGIGDMSYTVPSSFGTDYDPLISSNENYGSSETHETPSAP
VAGFSATPTSGNAPLTVNFTDQSTNTPTSWLWDFGDNSTDTEQNPSHVYASAGNYTVNLT
VANADGSDSEVKTECIVVSEPLSGAPVANFTANVTSGTAPLTVQFTDLSSGDGITSWAWD
FDSDGTVDSNETNPSHIYNSTGTYTVSLTVTGDGGSDTETKTNYITVSETVTESGWSQFQ
KDSSHTGYTFNSVPTQDPELLWQNLTSSEQEPCGSGGINVPPVISGNTVFVTAGNASVWA
FNKETGDLIWSKELGGDLTQTSTPAIGNGTLFVPTMEGNLYAFDQENGNELWKAHVTDGN
LECPITYSDHKLYIGDGLEGGTGTKYYYCYDDSGNLVWKHENNNMSGFLWSGAVVVGNYL
VYPVFEGKMVCLEKDTGTFVDEVDFSKSSDISFALSDPGMFRSSVTYAEGALYTSSERGQ
ETGYCFKVGFNPDTGQFLDSGWATSIGFSTSTPVVYDGRVYVGHGEHGETGSMFCLNDSD
GTVIWETPISGGVKSSPVLSVENGDPYIYFTEAIVDGSIYCLNPDGTLAWHYNPPEDSAY
TLQGAALSDGKVYYGTDNGYLYCIGQGEALPPEANFSSDKQTGSFPLTVSFKDRSFNANK
FLWDFGDGNTSTEVNPVHTYTAEGTYTVTLTVQNEHGTDKKVAEDYIYAVKVPTTWPIKR
GESIQAAINSADSGDIIKVYPGEYHEVLTIDKNLTLKGIKDPVLNASGFIDSSGVTISAD
GVEFSGFEITGTEEMCFAINVNAKNVLIEDNLIDDCAEGVWLQGTENTLRQNNISNCWDF
AAVLDSTGDNRIYKNTFINNNGKKMGGSNDHISGGSDSFFQSSEPVEYVWNGTKLTGYIG
NYYDDYAGSDSNGDGIGDTAYTADAGTDKYPLVLPYSNYVEEQKNESIPENSWYQFHGKV
DHLGYSESGPKTNQTEWISEDIDAISSSSPVAAGGKVFVICGTAGMEESTEDIPQLVALD
EFSGDILWNVSIPKAVYGSWASPAYDDGMVFTATGPELGCYDAETGEKIWCFNDTVGSQG
AVNSGPAIADGMVIFSDWDGSHYYCLDEYTGYLLWSFEVVGDAQSVPAYADGKFYLTSWG
YGTSYAGHAYCVDAVTGDQVWHINNIEQNFCGSPAYKDGVLYLTTYNFYGDGDLLALDAV
DGSIIWQQNIERTDSTPAFAYGNVYVCGGCSGFSNVQTYCFNASTGEKVWETPSLTGENG
GIGGWTCSVAVADGLVYVGTEGNGYFGYNDLYALDAFTGEVAWHTPHAGSTPALSDGMLF
SIGADQKVYAFKDSLSSPVADFSADITSGNAPLTVNFTDQSTGTVSSYSWDFNNDGTVDS
TEQNPSHTYNATGTYTVNLTVTNAKGSDSEVKTGYINVGSQSSAKPVAAFTASPTSGKTP
LKVKFTDTSTGSPTSWFWKFGDGSKSFLQNPVHKYSKAGIYTVNLTVKNAKGKNTVTKTE
YIKVITKPVANFSASPTSGKAPLKVTFTDTSTGIPAKWRWDFGDGAKSFLQNPVHKYSKA
GTYTVNLTVKNAKGKNTVTKTEYIKVITKPVANFNSSVTSGKAPLKVKFTDTSTGIPAKW
SWDFGDGSDSFHQNPIHKYSKAGTYTVNLTVKNAAGRNTVTKTEYIKIT
Download sequence
Identical sequences A0A0E3LLW8 Q46B15
gi|73669492|ref|YP_305507.1| 269797.Mbar_A1993 WP_011306973.1.36239 WP_011306973.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]