SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011307736.1.74748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011307736.1.74748
Domain Number 1 Region: 300-386
Classification Level Classification E-value
Superfamily PKD domain 7.19e-29
Family PKD domain 0.00039
Further Details:      
 
Domain Number 2 Region: 388-468
Classification Level Classification E-value
Superfamily PKD domain 3.01e-28
Family PKD domain 0.00048
Further Details:      
 
Domain Number 3 Region: 469-550
Classification Level Classification E-value
Superfamily PKD domain 1.06e-27
Family PKD domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011307736.1.74748
Sequence length 551
Comment hypothetical protein [Methanosarcina barkeri]; AA=GCF_000969985.1; RF=na; TAX=1434109; STAX=2208; NAME=Methanosarcina barkeri str. Wiesmoor; strain=Wiesmoor; AL=Complete Genome; RT=Major
Sequence
MNRKLILILLTLILSSGVCLADNFVGGIPLTSVHSGTVSGGVYCDSYYGTADQAIHTAKT
IDKTFTLPANAKVEWAMLLTTVYCGHMQNNYQGLAKVSFNGQTLGTETLNVPYNYITNGG
NDGKAYVQVNDHVDRVTSDYMMYYDVTSLVKSGKNKATVHTEPTDKKFDGRIKLITLIVA
YNDGSGKKIWYQVNRGHDPDTYYSENNLGENYIGSTAFKAALPASSTLTSATLTDVHMAS
TDGSYTFNGKTLTSGKPQGTYCGSDSWDVKNNFKSTGTNTLTYDRNAPFYKNSLAILTAE
YKTSSNKPVAAFSASPTSGKAPLKVKFTDTSTGIPSKWFWNFGDGSKSFQQNPVHKYSKA
GTYTVSLTVKNAKGKNTVTKTEYIKVIAKPVAAFSASPTFGKAPLKVKFTDKSTGTPKKW
KWNFGDGKISAKQNPIHKYSKAGKYKVTLTVANAAGINTVTKTNYITVIAKPVAAFSASP
TSGKAPLKVTFTDKSTGTPKKWKWNFGDGKISAKQNPIHKYSKAGKYKVTLTVANAAGIN
TKTISNYIIVK
Download sequence
Identical sequences A0A0E3QMI6 Q468J7
269797.Mbar_A2794 WP_011307736.1.36239 WP_011307736.1.74748 gi|73670260|ref|YP_306275.1| NYSGXRC-10384f

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]