SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011311396.1.100243 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011311396.1.100243
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-31
Family Sfri0576-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011311396.1.100243
Sequence length 122
Comment STAS/SEC14 domain-containing protein [Thiobacillus denitrificans]; AA=GCF_000012745.1; RF=representative genome; TAX=292415; STAX=36861; NAME=Thiobacillus denitrificans ATCC 25259; strain=ATCC 25259; AL=Complete Genome; RT=Major
Sequence
MISLDVDQNLIAVTVMGQFTLADYREFEEAVAHGIAFEGKVNLLFDLRDMLSYSVDVAWE
ELKFSREHKNDFGRIAILTGDEWVAWSMWVNRMFMSADIRLFDELEAAQAWVTGGELPAP
VI
Download sequence
Identical sequences Q3SKE6
gi|74316902|ref|YP_314642.1| WP_011311396.1.100243 372233 292415.Tbd_0884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]