SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011314364.1.37845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011314364.1.37845
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily SIS domain 8.29e-49
Family mono-SIS domain 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011314364.1.37845
Sequence length 197
Comment phosphoheptose isomerase [Nitrobacter winogradskyi]; AA=GCF_000012725.1; RF=representative genome; TAX=323098; STAX=913; NAME=Nitrobacter winogradskyi Nb-255; strain=Nb-255; AL=Complete Genome; RT=Major
Sequence
MSQNPIAVHFQQSLAALQRAANDTTLLAAASEIAVTIIDALRSGNKVLLIGNGGSAADAQ
HIASEIVGRYRKERPGYAAIALTTDTSALTAISNDYGFERIFCRQIESLGRPGDILLALS
TSGRSPNILTALDAARRLGLVTAGFTGLKGQSLREVCDHLLVAPSDDTPVIQQIHMTAAH
AICDTVEHALADGDSDR
Download sequence
Identical sequences Q3STR1
323098.Nwi_1068 gi|75675261|ref|YP_317682.1| WP_011314364.1.37845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]