SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011322900.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322900.1.57290
Domain Number 1 Region: 31-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000117
Family PadR-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011322900.1.57290
Sequence length 118
Comment transcription regulator [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MGSETTAGEARTDTDALPNKKPADLSKFQLRILAVLADAGDAPKGVTVKRRLQEYYSSDV
NPGQLYPNLNELVETGFVAKGQKDKRTNAYEITNDGQQALTSEVKWLAARTAGVAEEA
Download sequence
Identical sequences A0A1U7EW28
WP_011322900.1.57290 348780.NP2366A gi|76801826|ref|YP_326834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]