SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323155.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011323155.1.57290
Domain Number 1 Region: 64-135
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 4.19e-25
Family Iron-dependent repressor protein, dimerization domain 0.00041
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000467
Family Iron-dependent repressor protein 0.073
Further Details:      
 
Domain Number 3 Region: 148-216
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00000000000179
Family FeoA-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011323155.1.57290
Sequence length 219
Comment DtxR family transcriptional regulator [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MLSAVMEDYIKAIYALQNDTDERVGTSELADYMDVTSPTVSSMIKKLEERGLVDREEYRG
VRLTEEGEVVALEILRHHRLLEAFLTEHLDYDWADVHEEADRLEHHVSEELTERIAEALD
NPGVDPHGDPIPDADLELPEAGETTRLTAAAEGDTVVVRRIRHQGDEELRYLAAAGIEPD
VEIEVVEIAPFGLVTVQTPEGEQSLPEEIARLIEIDSDT
Download sequence
Identical sequences A0A1U7EWP6
gi|76802081|ref|YP_327089.1| WP_011323155.1.57290 348780.NP2878A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]