SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011331904.1.75567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011331904.1.75567
Domain Number 1 Region: 27-335
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.21e-87
Family Phosphate binding protein-like 0.00000000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011331904.1.75567
Sequence length 337
Comment MULTISPECIES: sulfate ABC transporter substrate-binding protein [Pseudomonas]; AA=GCF_900102735.1; RF=na; TAX=1566234; STAX=1566234; NAME=Pseudomonas sp. NFIX46; strain=NFIX46; AL=Scaffold; RT=Major
Sequence
MSSIRRYALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNAEFVKYWQSEHAGDTV
KIQQSHGGSGKQGRAVIDGLRADVVTLALAGDIDEIAKLGKTLPADWQKRLPDASTPYTS
TIVFLVRKGNPKGIKDWGDLIKNDVSVITPNPKTSGGARWNFLAAWAYGLKANGGNEAKA
KEYVQTLFKHVPVLDTGARGSTITFVNNGQGDVLLAWENEAFLALKEDGGKDKFDIVVPS
LSILAEPPVAVVDKNAEKKGNEQIAEAYLKHLYSPAGQEIAAKNFYRPRDKDVAAKYAQQ
FPKLELVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ
Download sequence
Identical sequences A0A0C1ZH63 A0A1G5N9N5 A0A1G6CC07 A0A2K4HUK3 Q3KJW8
WP_011331904.1.20937 WP_011331904.1.21389 WP_011331904.1.2668 WP_011331904.1.38776 WP_011331904.1.51676 WP_011331904.1.54387 WP_011331904.1.54700 WP_011331904.1.55771 WP_011331904.1.58385 WP_011331904.1.62013 WP_011331904.1.64081 WP_011331904.1.6588 WP_011331904.1.72974 WP_011331904.1.75567 WP_011331904.1.84829 WP_011331904.1.91175 WP_011331904.1.91687 WP_011331904.1.91867 WP_011331904.1.98588 WP_011331904.1.9994 gi|77456422|ref|YP_345927.1| 205922.Pfl01_0194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]