SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011332523.1.54387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011332523.1.54387
Domain Number 1 Region: 94-302
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.05e-37
Family Phosphate binding protein-like 0.0073
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.51e-20
Family LysR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011332523.1.54387
Sequence length 315
Comment MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]; AA=GCF_002113205.1; RF=na; TAX=1981743; STAX=1981743; NAME=Pseudomonas sp. B16(2017); strain=B16(2017); AL=Scaffold; RT=Major
Sequence
MSRQLHAQTYVWLQVFSCAARHLSFTRCAEELHITPGAVSQQIRQLEERLGFRLFHRRAR
GVELSAEGQRLAITVNEAYGSIDAELRRLDAGMISGILRVRSIPSFLSKWLTPRLPRLQQ
RYPDIQLRLVAEDSSVPLHEGDFDLAIDLNDGSYPGLLSTALLDEQIFPVCAPGLLRGRP
PLHGPADLVHFPLLHDITAWRGSYEYAEWEFYLNAIGFEGADVRRGHTFNRNHLTIEAAI
AGMGVAIARRTLLNDELERGTLIVPFGISVPNHKRYVLLYAPGALSHPGVRAVHDWLVEE
AGIFRSLHPLGDGQL
Download sequence
Identical sequences A0A0C2A2L7 A0A1G5MHY3 A0A1G6F0N9 A0A2K4HTY5 Q3KHU2
WP_011332523.1.15864 WP_011332523.1.20937 WP_011332523.1.21389 WP_011332523.1.2668 WP_011332523.1.32803 WP_011332523.1.38776 WP_011332523.1.51676 WP_011332523.1.53106 WP_011332523.1.54387 WP_011332523.1.55771 WP_011332523.1.58385 WP_011332523.1.58965 WP_011332523.1.62013 WP_011332523.1.64081 WP_011332523.1.6588 WP_011332523.1.72974 WP_011332523.1.75567 WP_011332523.1.84829 WP_011332523.1.91175 WP_011332523.1.91687 WP_011332523.1.91867 WP_011332523.1.96080 WP_011332523.1.98588 WP_011332523.1.9994 205922.Pfl01_0921 gi|77457148|ref|YP_346653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]