SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011332896.1.2668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011332896.1.2668
Domain Number 1 Region: 39-229
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000013
Family Phosphate binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011332896.1.2668
Sequence length 325
Comment MULTISPECIES: C4-dicarboxylate ABC transporter substrate-binding protein [Pseudomonas]; AA=GCF_000012445.1; RF=na; TAX=205922; STAX=294; NAME=Pseudomonas fluorescens Pf0-1; strain=Pf0-1; AL=Complete Genome; RT=Major
Sequence
MNRSLRRFALAAGCVLFAGQLMAEPKRPECIAPASPGGGFDLTCKLAQSALVNEKLLTKP
MRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDETNVRWLAAVG
TSYGAIAVKSDSPYKTLDDLVQALKKDPSSVVIGSGGTVGSQDWMQTALIAKAAGINPRD
LRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFAEKRLDEPEMKDIP
TAREQGYDIVWPVVRGFYLGPKVSDEDYAWWKDSFDKLLASEDFAKLRDQRELFPFAMTG
PELDTYVKKQVADYKVLAKEFGLIQ
Download sequence
Identical sequences Q3KGL0
WP_011332896.1.22023 WP_011332896.1.2668 WP_011332896.1.30523 WP_011332896.1.46399 WP_011332896.1.47897 205922.Pfl01_1353 gi|77457580|ref|YP_347085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]