SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011333412.1.20937 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011333412.1.20937
Domain Number 1 Region: 93-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.71e-32
Family Phosphate binding protein-like 0.00031
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-17
Family LysR-like transcriptional regulators 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011333412.1.20937
Sequence length 307
Comment MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]; AA=GCF_900115915.1; RF=na; TAX=1566233; STAX=1566233; NAME=Pseudomonas sp. NFIX49; strain=NFIX49; AL=Scaffold; RT=Major
Sequence
MNRNDLRRVDMNLLVIFEALMFEKNLTRVAEKLFMGQPAVSAALGRLRDLFDDPLLLRNG
RGMEPTARALAILQELQPAMDVISGAVSRAKEFDPATSCDVFRIGLSDDAEFGLFPPLLR
QLQEEAPGIVVVVRRANYLLMPGLLASGEISVGVSYTTDLPANAKRKKLRDIPCKVLRGD
NRPGPLTLDEYCERPHAMVSFSGDLSGNIDMDLAKVGRSRRVVLGVPQFSGLRALLAGTE
MIATVPDYAACALVEGCALRAEDPPFPIDAAQLSMAWSGVHDNDPAEKWLRSRISQFMSV
TLDIPAV
Download sequence
Identical sequences A0A0C1WLZ5 A0A173J0B7 A0A1G5MS58 A0A1G6AFJ1 A0A2K4HG35 Q3KEV1
gi|77458189|ref|YP_347694.1| 205922.Pfl01_1962 WP_011333412.1.20937 WP_011333412.1.22023 WP_011333412.1.2668 WP_011333412.1.30523 WP_011333412.1.38776 WP_011333412.1.46399 WP_011333412.1.47897 WP_011333412.1.51676 WP_011333412.1.54700 WP_011333412.1.55771 WP_011333412.1.58385 WP_011333412.1.64081 WP_011333412.1.6588 WP_011333412.1.75567 WP_011333412.1.91175 WP_011333412.1.91687 WP_011333412.1.98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]