SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011333760.1.2668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011333760.1.2668
Domain Number 1 Region: 27-267
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-65
Family Phosphate binding protein-like 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011333760.1.2668
Sequence length 269
Comment metal ABC transporter substrate-binding protein [Pseudomonas fluorescens]; AA=GCF_000012445.1; RF=na; TAX=205922; STAX=294; NAME=Pseudomonas fluorescens Pf0-1; strain=Pf0-1; AL=Complete Genome; RT=Major
Sequence
MLKKAGLTLAVLGALVTSFSAQALEPLRVAADPVPHAQILTYIQKLDPQLNLKVIEIPQG
VNSNELLVHGDVDANYFQHLPYLQSQEKALGEKLAVAATVHIEPLGIYSHRHKTFAQVPD
RGTVAVPNNVTNLSRALYLLQDNGLIKLKPGFNDPAADQATPKDIAENPKQLKILEIESP
QLPRALDDVDLAVINGNYALEAGLVPARDALGLEKAEHNPYANILVTTPKLENDPRIQQL
AKDLTSPQVAKYIAENFKGSVIPVADAKP
Download sequence
Identical sequences Q3KDS8
205922.Pfl01_2335 WP_011333760.1.2668 gi|77458562|ref|YP_348067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]