SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011334135.1.64081 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011334135.1.64081
Domain Number 1 Region: 102-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-36
Family Phosphate binding protein-like 0.017
Further Details:      
 
Domain Number 2 Region: 12-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-20
Family LysR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011334135.1.64081
Sequence length 304
Comment MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]; AA=GCF_002113625.1; RF=na; TAX=1981719; STAX=1981719; NAME=Pseudomonas sp. B38(2017); strain=B38(2017); AL=Scaffold; RT=Major
Sequence
MSSSGEAPPILPPLKAIQAFEQTARFGNVARAAEVLDLTPSAVSHQLAKLEAMIGRQLFL
RTARGVTLTPVGEQYLSEISGILHSLAVATERATSDVSLDCLRLHSSPSFGLLWLMPRLE
QFRESHPDIQLNLSCSYESLHFSRDKIDVDIRHGMPNWPSFEVRTLRNEKIAVLASPKLL
EKRPIRAVADLLDCNLILSEATLIKWPQLFAQHGLSRPESPYTLSFDRSYMTLEAASHGL
GFALESTLLAQDYLARGELVEVIPGLSAPITAHHLVFPKAHAGFPRVRRFLEWMQRELGH
DFSY
Download sequence
Identical sequences A0A173J1Y0 A0A1G5NQH6 A0A1G6DUU7 A0A2K4HYH5 Q3KCP2
gi|77458947|ref|YP_348453.1| WP_011334135.1.20937 WP_011334135.1.22023 WP_011334135.1.2668 WP_011334135.1.30523 WP_011334135.1.38776 WP_011334135.1.46399 WP_011334135.1.47897 WP_011334135.1.51676 WP_011334135.1.54700 WP_011334135.1.55771 WP_011334135.1.58385 WP_011334135.1.64081 WP_011334135.1.6588 WP_011334135.1.75567 WP_011334135.1.91175 WP_011334135.1.98588 205922.Pfl01_2722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]