SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011334266.1.2668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011334266.1.2668
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.84e-53
Family Phosphate binding protein-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011334266.1.2668
Sequence length 274
Comment ABC transporter substrate-binding protein [Pseudomonas fluorescens]; AA=GCF_000012445.1; RF=na; TAX=205922; STAX=294; NAME=Pseudomonas fluorescens Pf0-1; strain=Pf0-1; AL=Complete Genome; RT=Major
Sequence
MKNFVIPAVLTSLMSCGVAVAAELPASIKEKGEIVVAIMPNYPPMDFKDPATNKLTGLDY
DLGNALAERLGVKIKWQETGFEQMINALTTERVDMVLSGMTDTAERQASVTFVDYFTSGP
QFYTLQKNATTNEIIDLCGKKVGTSRRTTFPAEIAAWSKENCEAAGKPAINVIGTEGSAD
ARAQLRQSRIDAAMQGSETLSYLKTQEKDMYKTVGQPISVQFTGLGVSKKKPELSEAVKV
ALQSMVDDGSYNAILKKWDLELGAIKDVTINAGK
Download sequence
Identical sequences Q3KCA9
WP_011334266.1.2668 205922.Pfl01_2855 gi|77459080|ref|YP_348586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]